Recombinant Mouse ADAM12 Protein (206-706 aa), His-Myc-tagged
Cat.No. : | ADAM12-2799M |
Product Overview : | Recombinant Mouse ADAM12 Protein (206-706 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 206-706 aa |
Description : | Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 58.4 kDa |
AA Sequence : | ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Adam12 a disintegrin and metallopeptidase domain 12 (meltrin alpha) [ Mus musculus ] |
Official Symbol | ADAM12 |
Synonyms | ADAM12; ADAM 12; meltrin alpha; meltrin-alpha; Mltna; mKIAA4001; |
Gene ID | 11489 |
mRNA Refseq | NM_007400 |
Protein Refseq | NP_031426 |
UniProt ID | Q61824 |
◆ Recombinant Proteins | ||
ADAM12-848HF | Recombinant Full Length Human ADAM12 Protein, GST-tagged | +Inquiry |
ADAM12-274H | Recombinant Human ADAM12 Protein, GST-tagged | +Inquiry |
ADAM12-307M | Recombinant Mouse ADAM12 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAM12-1933H | Recombinant Human ADAM12 protein, GST-tagged | +Inquiry |
ADAM12-216H | Recombinant Human ADAM12, C13&N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM12-2592HCL | Recombinant Human ADAM12 cell lysate | +Inquiry |
CPBT-676RH | Rabbit Anti-Human ADAM Metallopeptidase Domain 12 Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM12 Products
Required fields are marked with *
My Review for All ADAM12 Products
Required fields are marked with *