Recombinant Mouse Aope Protein, His-tagged
| Cat.No. : | Apoe-1129M |
| Product Overview : | Recombinant Mouse Aope Protein (19-311aa) was expressed in E. coli with 6His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-311 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 38 kDa |
| AA Sequence : | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Apoe apolipoprotein E [ Mus musculus (house mouse) ] |
| Official Symbol | Apoe |
| Synonyms | Apoe; apolipoprotein E; Apo-E; AI255918 |
| Gene ID | 11816 |
| mRNA Refseq | NM_001305819.1 |
| Protein Refseq | NP_001292748.1 |
| UniProt ID | P08226 |
| ◆ Recombinant Proteins | ||
| APOE4-2868H | Recombinant Human APOE4 protein, hFc-tagged | +Inquiry |
| APOE4-2869HB | Recombinant Human APOE4 protein, His-Trx-tagged, Amine-Labeled Biotinylated | +Inquiry |
| Apoe-6433M | Recombinant Mouse Apoe protein, hFc-tagged | +Inquiry |
| APOE-57H | Recombinant Human APOE protein, His-tagged | +Inquiry |
| APOE-694H | Recombinant Human Apolipoprotein E, E4 Isoform | +Inquiry |
| ◆ Native Proteins | ||
| ApoE-3560H | Native Human ApoE | +Inquiry |
| APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
| APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoe Products
Required fields are marked with *
My Review for All Apoe Products
Required fields are marked with *
