Recombinant Mouse Aope Protein, His-tagged

Cat.No. : Apoe-1129M
Product Overview : Recombinant Mouse Aope Protein (19-311aa) was expressed in E. coli with 6His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 19-311 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 38 kDa
AA Sequence : EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Apoe apolipoprotein E [ Mus musculus (house mouse) ]
Official Symbol Apoe
Synonyms Apoe; apolipoprotein E; Apo-E; AI255918
Gene ID 11816
mRNA Refseq NM_001305819.1
Protein Refseq NP_001292748.1
UniProt ID P08226

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Apoe Products

Required fields are marked with *

My Review for All Apoe Products

Required fields are marked with *

0
cart-icon