Recombinant Mouse Aope Protein, His-tagged
| Cat.No. : | Apoe-1129M |
| Product Overview : | Recombinant Mouse Aope Protein (19-311aa) was expressed in E. coli with 6His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-311 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 38 kDa |
| AA Sequence : | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Apoe apolipoprotein E [ Mus musculus (house mouse) ] |
| Official Symbol | Apoe |
| Synonyms | Apoe; apolipoprotein E; Apo-E; AI255918 |
| Gene ID | 11816 |
| mRNA Refseq | NM_001305819.1 |
| Protein Refseq | NP_001292748.1 |
| UniProt ID | P08226 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoe Products
Required fields are marked with *
My Review for All Apoe Products
Required fields are marked with *




