Recombinant Mouse Aope Protein, His-tagged
Cat.No. : | Apoe-1129M |
Product Overview : | Recombinant Mouse Aope Protein (19-311aa) was expressed in E. coli with 6His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-311 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 38 kDa |
AA Sequence : | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Apoe apolipoprotein E [ Mus musculus (house mouse) ] |
Official Symbol | Apoe |
Synonyms | Apoe; apolipoprotein E; Apo-E; AI255918 |
Gene ID | 11816 |
mRNA Refseq | NM_001305819.1 |
Protein Refseq | NP_001292748.1 |
UniProt ID | P08226 |
◆ Recombinant Proteins | ||
APOE-638M | Recombinant Mouse APOE Protein, His (Fc)-Avi-tagged | +Inquiry |
APOE-2630H | Recombinant Human Apolipoprotein E, E2 Isoforms | +Inquiry |
APOE-2541R | Recombinant Rabbit APOE protein, His-SUMO & Myc-tagged | +Inquiry |
APOE-17H | Recombinant Human APOE Protein, His-tagged | +Inquiry |
Apoe-5608M | Recombinant Mouse Apoe protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoe Products
Required fields are marked with *
My Review for All Apoe Products
Required fields are marked with *