Recombinant Mouse Aplnr protein, His&Myc-tagged
| Cat.No. : | Aplnr-019M |
| Product Overview : | Recombinant Mouse Aplnr protein(Q9WV08)(307-377aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 307-377aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 15.1 kDa |
| AA Sequence : | YAFFDPRFRQACTSMLCCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVD |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Aplnr apelin receptor [ Mus musculus ] |
| Official Symbol | Aplnr |
| Synonyms | APLNR; apelin receptor; MSR; angiotensin receptor-like 1; G-protein coupled receptor APJ; APJ; Agtrl1; msr/apj; |
| Gene ID | 23796 |
| mRNA Refseq | NM_011784 |
| Protein Refseq | NP_035914 |
| ◆ Recombinant Proteins | ||
| APLNR-2041H | Recombinant Human APLNR Full Length Transmembrane protein(Nanodisc) | +Inquiry |
| RFL-2805RF | Recombinant Full Length Rat Apelin Receptor(Aplnr) Protein, His-Tagged | +Inquiry |
| APLNR-358R | Recombinant Rhesus monkey APLNR Protein, His-tagged | +Inquiry |
| APLNR-596HFL | Recombinant Full Length Human APLNR Protein, C-Flag-tagged | +Inquiry |
| APLNR-1015HF | Recombinant Full Length Human APLNR Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APLNR-8791HCL | Recombinant Human APLNR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Aplnr Products
Required fields are marked with *
My Review for All Aplnr Products
Required fields are marked with *
