Recombinant Mouse Apoe protein, His-tagged
Cat.No. : | Apoe-1128M |
Product Overview : | Recombinant Mouse Apoe protein(P08226)(19-311aa), fused to N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-311aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.0kDa |
AA Sequence : | EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Apoe apolipoprotein E [ Mus musculus (house mouse) ] |
Official Symbol | Apoe |
Synonyms | Apoe; apolipoprotein E; Apo-E; AI255918 |
Gene ID | 11816 |
mRNA Refseq | NM_001305819.1 |
Protein Refseq | NP_001292748.1 |
UniProt ID | P08226 |
◆ Recombinant Proteins | ||
APOE-726R | Recombinant Full Length Rat apolipoprotein E Protein, His tagged | +Inquiry |
APOE-382R | Recombinant Rat APOE Protein, His (Fc)-Avi-tagged | +Inquiry |
APOE-088H | Active Recombinant Human APOE Protein, Myc/DDK-tagged | +Inquiry |
APOE4-2871H | Active Recombinant Human APOE4 protein(C130R), His-Avi-tagged, Biotinylated | +Inquiry |
APOE-638M | Recombinant Mouse APOE Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoe Products
Required fields are marked with *
My Review for All Apoe Products
Required fields are marked with *