Recombinant Mouse Aqp7 protein, His-GFP-tagged

• Cat.No.: Aqp7-4687M
• Product Overview: Recombinant Mouse Aqp7 protein(O54794)(221-303 aa), fused with C-terminal His and GFP tag, was expressed in Yeast.

Specification

• Species: Mouse
• Source: Yeast
• Tag: GFP&His
• Protein Length: 221-303 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 37.6 kDa
• AASequence: FTFIAGWGKQVFRAGNNWWWVPVVAPLLGAYLGGIVYLGLIHPSIPQDPQRLENFTARDQKVTASYKNAASANISGSVPLEHF
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Aqp7 aquaporin 7 [ Mus musculus ]
• Official Symbol: Aqp7
• Synonyms: AQP7; aquaporin 7; aquaporin-7; AQP-7; aquaglyceroporin-7; AQP7L; AQPap
• Gene ID: 11832
• mRNA Refseq: NM_007473
• Protein Refseq: NP_031499