Recombinant Mouse Aqp7 protein, His-GFP-tagged
| Cat.No. : | Aqp7-4687M |
| Product Overview : | Recombinant Mouse Aqp7 protein(O54794)(221-303 aa), fused with C-terminal His and GFP tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | GFP&His |
| Protein Length : | 221-303 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 37.6 kDa |
| AASequence : | FTFIAGWGKQVFRAGNNWWWVPVVAPLLGAYLGGIVYLGLIHPSIPQDPQRLENFTARDQKVTASYKNAASANISGSVPLEHF |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Aqp7 aquaporin 7 [ Mus musculus ] |
| Official Symbol | Aqp7 |
| Synonyms | AQP7; aquaporin 7; aquaporin-7; AQP-7; aquaglyceroporin-7; AQP7L; AQPap; |
| Gene ID | 11832 |
| mRNA Refseq | NM_007473 |
| Protein Refseq | NP_031499 |
| ◆ Recombinant Proteins | ||
| RFL-20874RF | Recombinant Full Length Rat Aquaporin-7(Aqp7) Protein, His-Tagged | +Inquiry |
| Aqp7-3603R | Recombinant Rat Aqp7, His-tagged | +Inquiry |
| RFL21790MF | Recombinant Full Length Milnesium Tardigradum Aquaporin-7(Aqp7) Protein, Tag-Free | +Inquiry |
| AQP7-397R | Recombinant Rat AQP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AQP7-307C | Recombinant Cynomolgus AQP7 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AQP7-104HCL | Recombinant Human AQP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Aqp7 Products
Required fields are marked with *
My Review for All Aqp7 Products
Required fields are marked with *
