Recombinant Mouse ATOH1 Protein (1-351 aa), His-tagged

• Cat.No.: ATOH1-2419M
• Product Overview: Recombinant Mouse ATOH1 Protein (1-351 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-351 aa
• Description: Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 41.9 kDa
• AA Sequence: MSRLLHAEEWAEVKELGDHHRHPQPHHVPPLTPQPPATLQARDLPVYPAELSLLDSTDPRAWLTPTLQGLCTARAAQYLLHSPELGASEAAAPRDEADSQGELVRRSGCGGLSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPNVGEQPPPPTASCKNDHHHLRTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPVQEDNSKTSPRSHRSDGEFSPHSHYSDSDEAS
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Atoh1 atonal homolog 1 (Drosophila) [ Mus musculus ]
• Official Symbol: ATOH1
• Synonyms: ATOH1; atonal homolog 1 (Drosophila); protein atonal homolog 1; Hath1; Math1; MATH-1; bHLHa14
• Gene ID: 11921
• mRNA Refseq: NM_007500
• Protein Refseq: NP_031526
• UniProt ID: P48985