Recombinant Mouse ATP5G1 Protein, His-tagged
Cat.No. : | ATP5G1-2135M |
Product Overview : | Recombinant Mouse ATP5G1 Protein(NP_001154891.1), fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Form : | Lyophilized from 20 mM Tris-HCl, 0.15M NaCl, 0.05%Brij78, 6% Trehalose, pH 8.0. The volume before lyophilization is 20μl/vial |
Molecular Mass : | The protein has a calculated MW of 18 kDa. |
AA Sequence : | DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM |
Purity : | ≥85%, by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Atp5g1 ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [ Mus musculus (house mouse) ] |
Official Symbol | ATP5G1 |
Synonyms | Atp5mc1 |
Gene ID | 11951 |
mRNA Refseq | NM_001161419.1 |
Protein Refseq | NP_001154891.1 |
UniProt ID | Q9CR84 |
◆ Recombinant Proteins | ||
ATP5G1-457R | Recombinant Rhesus monkey ATP5G1 Protein, His-tagged | +Inquiry |
RFL27757HF | Recombinant Full Length Human Atp Synthase Lipid-Binding Protein, Mitochondrial(Atp5G1) Protein, His-Tagged | +Inquiry |
ATP5G1-528R | Recombinant Rat ATP5G1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP5G1-12267Z | Recombinant Zebrafish ATP5G1 | +Inquiry |
ATP5G1-2135M | Recombinant Mouse ATP5G1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5G1-8600HCL | Recombinant Human ATP5G1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5G1 Products
Required fields are marked with *
My Review for All ATP5G1 Products
Required fields are marked with *