Recombinant Mouse Bcat1 protein, His-tagged
Cat.No. : | Bcat1-2577M |
Product Overview : | Recombinant Mouse Bcat1 protein(P24288)(1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-386aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.4 kDa |
AA Sequence : | MKDCSNGCSAPFAGERGSEEVAETFRAKDLIITPATVLKEKPDPDSLVFGATFTDHMLTVEWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFRGVDNKIRLFRPDLNMDRMCRSAVRTTLPMFDKEELLKCILQLLQIDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPSKALLFVILSPVGPYFSSGSFTPVSLWANPKYIRAWKGGTGDCKMGGNYGASLLAQCEAVENGCQQVLWLYGKDNQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRQSILELAQQWGEFKVCERHLTMDDLATALEGNRVKEMFGSGTACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTIELP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Bcat1 branched chain aminotransferase 1, cytosolic [ Mus musculus ] |
Official Symbol | Bcat1 |
Synonyms | BCAT1; branched chain aminotransferase 1, cytosolic; branched-chain-amino-acid aminotransferase, cytosolic; BCAT(c); BCATc; Eca39; |
Gene ID | 12035 |
mRNA Refseq | NM_001024468 |
Protein Refseq | NP_001019639 |
◆ Recombinant Proteins | ||
BCAT1-0244H | Recombinant Human BCAT1 Protein (K2-S386), Tag Free | +Inquiry |
Bcat1-1037R | Recombinant Rat Bcat1 protein, His & T7-tagged | +Inquiry |
BCAT1-10169H | Recombinant Human BCAT1, GST-tagged | +Inquiry |
BCAT1-1043H | Recombinant Human BCAT1 protein, T7-His-TEV cleavage site-tagged | +Inquiry |
BCAT1-1608HF | Recombinant Full Length Human BCAT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAT1-8495HCL | Recombinant Human BCAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bcat1 Products
Required fields are marked with *
My Review for All Bcat1 Products
Required fields are marked with *