Recombinant Mouse Bcat1 protein, His-tagged
| Cat.No. : | Bcat1-2577M |
| Product Overview : | Recombinant Mouse Bcat1 protein(P24288)(1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-386aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 46.4 kDa |
| AA Sequence : | MKDCSNGCSAPFAGERGSEEVAETFRAKDLIITPATVLKEKPDPDSLVFGATFTDHMLTVEWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFRGVDNKIRLFRPDLNMDRMCRSAVRTTLPMFDKEELLKCILQLLQIDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPSKALLFVILSPVGPYFSSGSFTPVSLWANPKYIRAWKGGTGDCKMGGNYGASLLAQCEAVENGCQQVLWLYGKDNQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRQSILELAQQWGEFKVCERHLTMDDLATALEGNRVKEMFGSGTACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTIELP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Bcat1 branched chain aminotransferase 1, cytosolic [ Mus musculus ] |
| Official Symbol | Bcat1 |
| Synonyms | BCAT1; branched chain aminotransferase 1, cytosolic; branched-chain-amino-acid aminotransferase, cytosolic; BCAT(c); BCATc; Eca39; |
| Gene ID | 12035 |
| mRNA Refseq | NM_001024468 |
| Protein Refseq | NP_001019639 |
| ◆ Recombinant Proteins | ||
| BCAT1-0244H | Recombinant Human BCAT1 Protein (K2-S386), Tag Free | +Inquiry |
| Bcat1-1037R | Recombinant Rat Bcat1 protein, His & T7-tagged | +Inquiry |
| BCAT1-10169H | Recombinant Human BCAT1, GST-tagged | +Inquiry |
| BCAT1-1043H | Recombinant Human BCAT1 protein, T7-His-TEV cleavage site-tagged | +Inquiry |
| BCAT1-1608HF | Recombinant Full Length Human BCAT1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCAT1-8495HCL | Recombinant Human BCAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bcat1 Products
Required fields are marked with *
My Review for All Bcat1 Products
Required fields are marked with *
