Recombinant Mouse Bgn protein, His-tagged
| Cat.No. : | Bgn-2591M |
| Product Overview : | Recombinant Mouse Bgn protein(P28653)(38-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 38-369aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.4 kDa |
| AA Sequence : | DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Bgn biglycan [ Mus musculus ] |
| Official Symbol | Bgn |
| Synonyms | BGN; biglycan; bone/cartilage proteoglycan I; BG; PGI; DSPG1; PG-S1; SLRR1A; |
| Gene ID | 12111 |
| mRNA Refseq | NM_007542 |
| Protein Refseq | NP_031568 |
| ◆ Recombinant Proteins | ||
| BGN-1427H | Recombinant Human BGN Protein (Glu20-Lys368), C-His tagged | +Inquiry |
| BGN-44H | Recombinant Human BGN protein (Asp38-Lys368), His-tagged | +Inquiry |
| BGN-206H | Recombinant Human BGN Protein, GST-tagged | +Inquiry |
| BGN-3401H | Recombinant Human BGN protein, His-tagged | +Inquiry |
| BGN-2339M | Recombinant Mouse BGN protein(Met1-Lys369), hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BGN-1124MCL | Recombinant Mouse BGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bgn Products
Required fields are marked with *
My Review for All Bgn Products
Required fields are marked with *



