Recombinant Mouse C1ql3 protein, His&Myc-tagged

• Cat.No.: C1ql3-2339M
• Product Overview: Recombinant Mouse C1ql3 protein(Q9ESN4)(21-255aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His&Myc
• Protein Length: 21-255aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.6 kDa
• AA Sequence: HYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: C1ql3 C1q-like 3 [ Mus musculus ]
• Official Symbol: C1ql3
• Synonyms: C1QL3; C1q-like 3; complement C1q-like protein 3; gliacolin; C1q/TNF-related protein 13; C1ql; K100; AI661623; C1qtnf13; 1110065A22Rik
• Gene ID: 227580
• mRNA Refseq: NM_153155
• Protein Refseq: NP_694795