Recombinant Mouse C1ql3 protein, His&Myc-tagged
Cat.No. : | C1ql3-2339M |
Product Overview : | Recombinant Mouse C1ql3 protein(Q9ESN4)(21-255aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 21-255aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.6 kDa |
AA Sequence : | HYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | C1ql3 C1q-like 3 [ Mus musculus ] |
Official Symbol | C1ql3 |
Synonyms | C1QL3; C1q-like 3; complement C1q-like protein 3; gliacolin; C1q/TNF-related protein 13; C1ql; K100; AI661623; C1qtnf13; 1110065A22Rik; |
Gene ID | 227580 |
mRNA Refseq | NM_153155 |
Protein Refseq | NP_694795 |
◆ Recombinant Proteins | ||
C1QL3-5830HFL | Recombinant Full Length Human C1QL3 protein, Flag-tagged | +Inquiry |
C1QL3-589R | Recombinant Rhesus monkey C1QL3 Protein, His-tagged | +Inquiry |
C1QL3-53H | Recombinant Human C1QL3 protein, MYC/DDK-tagged | +Inquiry |
C1ql3-2339M | Recombinant Mouse C1ql3 protein, His&Myc-tagged | +Inquiry |
C1QL3-52H | Active Recombinant Human C1QL3 protein, Met/His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1ql3 Products
Required fields are marked with *
My Review for All C1ql3 Products
Required fields are marked with *