Recombinant Mouse C1ql3 protein, His&Myc-tagged

Cat.No. : C1ql3-2339M
Product Overview : Recombinant Mouse C1ql3 protein(Q9ESN4)(21-255aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His&Myc
Protein Length : 21-255aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 28.6 kDa
AA Sequence : HYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name C1ql3 C1q-like 3 [ Mus musculus ]
Official Symbol C1ql3
Synonyms C1QL3; C1q-like 3; complement C1q-like protein 3; gliacolin; C1q/TNF-related protein 13; C1ql; K100; AI661623; C1qtnf13; 1110065A22Rik;
Gene ID 227580
mRNA Refseq NM_153155
Protein Refseq NP_694795

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1ql3 Products

Required fields are marked with *

My Review for All C1ql3 Products

Required fields are marked with *

0
cart-icon