Recombinant Mouse C1QTNF3 Protein (23-246 aa), His-Myc-tagged
Cat.No. : | C1QTNF3-2504M |
Product Overview : | Recombinant Mouse C1QTNF3 Protein (23-246 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 23-246 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.1 kDa |
AA Sequence : | QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | C1qtnf3 C1q and tumor necrosis factor related protein 3 [ Mus musculus ] |
Official Symbol | C1QTNF3 |
Synonyms | C1QTNF3; cartducin; cartonectin; secretory protein CORS26; Cors; CTRP3; Corcs; CORS-26; 2310005P21Rik; |
Gene ID | 81799 |
mRNA Refseq | NM_001204134 |
Protein Refseq | NP_001191063 |
UniProt ID | Q9ES30 |
◆ Recombinant Proteins | ||
C1QTNF3-2464H | Recombinant Human C1QTNF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C1QTNF3-3322H | Recombinant Human C1QTNF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C1QTNF3-1852HFL | Recombinant Full Length Human C1QTNF3 Protein, C-Flag-tagged | +Inquiry |
C1QTNF3-4240H | Recombinant Human C1q And Tumor Necrosis Factor Related Protein 3, His-tagged | +Inquiry |
C1QTNF3-2801Z | Recombinant Zebrafish C1QTNF3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF3-8136HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
C1QTNF3-8137HCL | Recombinant Human C1QTNF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QTNF3 Products
Required fields are marked with *
My Review for All C1QTNF3 Products
Required fields are marked with *
0
Inquiry Basket