Recombinant Mouse Camp protein, His-SUMO-tagged

• Cat.No.: Camp-4619M
• Product Overview: Recombinant Mouse Camp protein(P51437)(135-172 aa), fused with N-terminal His and SUMO tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 135-172 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 17.2 kDa
• AASequence: ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: Camp cathelicidin antimicrobial peptide [ Mus musculus ]
• Official Symbol: Camp
• Synonyms: CAMP; cathelicidin antimicrobial peptide; cathelin-related antimicrobial peptide; CLP; cathelin-like protein; Cnlp; MCLP; CAP18; Cramp; FALL39
• Gene ID: 12796
• mRNA Refseq: NM_009921
• Protein Refseq: NP_034051