Recombinant Mouse Camp protein, His-SUMO-tagged
| Cat.No. : | Camp-4619M |
| Product Overview : | Recombinant Mouse Camp protein(P51437)(135-172 aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 135-172 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 17.2 kDa |
| AASequence : | ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Camp cathelicidin antimicrobial peptide [ Mus musculus ] |
| Official Symbol | Camp |
| Synonyms | CAMP; cathelicidin antimicrobial peptide; cathelin-related antimicrobial peptide; CLP; cathelin-like protein; Cnlp; MCLP; CAP18; Cramp; FALL39; |
| Gene ID | 12796 |
| mRNA Refseq | NM_009921 |
| Protein Refseq | NP_034051 |
| ◆ Recombinant Proteins | ||
| Camp-661M | Recombinant Mouse Camp Protein, His/GST-tagged | +Inquiry |
| CAMP-2767H | Recombinant Human CAMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Camp-4619M | Recombinant Mouse Camp protein, His-SUMO-tagged | +Inquiry |
| CAMP-0346H | Recombinant Human CAMP Protein, GST-Tagged | +Inquiry |
| Camp-360M | Recombinant Mouse Camp Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAMP-7871HCL | Recombinant Human CAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Camp Products
Required fields are marked with *
My Review for All Camp Products
Required fields are marked with *
