Recombinant Mouse Camp protein, His-SUMO-tagged
Cat.No. : | Camp-4619M |
Product Overview : | Recombinant Mouse Camp protein(P51437)(135-172 aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 135-172 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 17.2 kDa |
AASequence : | ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Camp cathelicidin antimicrobial peptide [ Mus musculus ] |
Official Symbol | Camp |
Synonyms | CAMP; cathelicidin antimicrobial peptide; cathelin-related antimicrobial peptide; CLP; cathelin-like protein; Cnlp; MCLP; CAP18; Cramp; FALL39; |
Gene ID | 12796 |
mRNA Refseq | NM_009921 |
Protein Refseq | NP_034051 |
◆ Recombinant Proteins | ||
CAMP-2795HF | Recombinant Full Length Human CAMP Protein, GST-tagged | +Inquiry |
Camp-661M | Recombinant Mouse Camp Protein, His/GST-tagged | +Inquiry |
CAMP-660H | Recombinant Human CAMP Protein, His-tagged | +Inquiry |
CAMP-491H | Recombinant Human CAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMP-0867H | Recombinant Human CAMP Protein (Gln31-Ser170), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMP-7871HCL | Recombinant Human CAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Camp Products
Required fields are marked with *
My Review for All Camp Products
Required fields are marked with *