Recombinant Mouse Cbln3 protein, His-SUMO-tagged
Cat.No. : | Cbln3-2471M |
Product Overview : | Recombinant Mouse Cbln3 protein(Q9JHG0)(25-197aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-197aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.4 kDa |
AA Sequence : | QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cbln3 cerebellin 3 precursor protein [ Mus musculus ] |
Official Symbol | Cbln3 |
Synonyms | CBLN3; cerebellin 3 precursor protein; cerebellin-3; precerebellin 3; |
Gene ID | 56410 |
mRNA Refseq | NM_019820 |
Protein Refseq | NP_062794 |
◆ Recombinant Proteins | ||
CBLN3-2784M | Recombinant Mouse CBLN3 Protein | +Inquiry |
CBLN3-2726H | Recombinant Human CBLN3 Protein, MYC/DDK-tagged | +Inquiry |
Cbln3-1977M | Recombinant Mouse Cbln3 Protein, Myc/DDK-tagged | +Inquiry |
Cbln3-635M | Recombinant Mouse Cbln3 Protein, His-tagged | +Inquiry |
CBLN3-642R | Recombinant Rhesus monkey CBLN3 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cbln3 Products
Required fields are marked with *
My Review for All Cbln3 Products
Required fields are marked with *
0
Inquiry Basket