Active Recombinant Mouse Ccl19 Protein
Cat.No. : | Ccl19-0620M |
Product Overview : | Mouse Ccl19 (Q548P0) recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Description : | Chemokine (C-C motif) ligand 19 (CCL19) is a small cytokine belonging to the CC chemokine family that is also known as EBI1 ligand chemokine (ELC) and macrophage inflammatory protein-3-beta (MIP-3-beta). CCL19 is expressed abundantly in thymus and lymph nodes, with moderate levels in trachea and colon and low levels in stomach, small intestine, lung, kidney and spleen. |
Form : | Lyophlized |
Bio-activity : | The activity is determined by the ability to chemoattract primary human T cells and is detectable starting at 20 ng/mL. |
Molecular Mass : | 7.9 kDa |
AA Sequence : | GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS |
Endotoxin : | < 0.1 EU/μg |
Applications : | Functional Study SDS-PAGE |
Storage : | Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | No additive |
Gene Name | Ccl19 chemokine (C-C motif) ligand 19 [ Mus musculus ] |
Official Symbol | Ccl19 |
Synonyms | CCL19; chemokine (C-C motif) ligand 19; C-C motif chemokine 19; chemokine CCL19; EBI1 ligand chemokine; EBI1-ligand chemokine; EBI-1 ligand chemokine; small inducible cytokine A19; small-inducible cytokine A19; EBV-induced molecule 1 ligand chemokine; epstein-Barr virus-induced molecule 1 ligand chemokine; ELC; CKb11; MIP3B; Scya19; exodus-3; |
Gene ID | 24047 |
mRNA Refseq | NM_011888 |
Protein Refseq | NP_036018 |
◆ Recombinant Proteins | ||
CCL19-014H | Recombinant Human CCL19 Protein, Biotinylated | +Inquiry |
Ccl19-022C | Active Recombinant Mouse Ccl19 Protein (83 aa) | +Inquiry |
Ccl19-2029M | Active Recombinant Mouse Ccl19 Protein | +Inquiry |
CCL19-371C | Recombinant Cynomolgus CCL19 Protein, His-tagged | +Inquiry |
Ccl19-0620M | Active Recombinant Mouse Ccl19 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL19-7729HCL | Recombinant Human CCL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl19 Products
Required fields are marked with *
My Review for All Ccl19 Products
Required fields are marked with *
0
Inquiry Basket