Recombinant Mouse Ccr1 Full Length Transmembrane protein, His-tagged

Cat.No. : Ccr1-2945M
Product Overview : Recombinant Mouse Ccr1 protein(P51675)(1-355aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-355aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 43.7 kDa
AA Sequence : MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Ccr1 chemokine (C-C motif) receptor 1 [ Mus musculus ]
Official Symbol Ccr1
Synonyms CCR1; chemokine (C-C motif) receptor 1; C-C chemokine receptor type 1; CCR-1; CC-CKR-1; RANTES-R; C-C CKR-1; MIP-1 alphaR; MIP-1alpha-R; MIP-1 alpha R; chemokine (C-C) receptor 1; macrophage inflammatory protein 1-alpha receptor; Cmkbr1; Mip-1a-R;
Gene ID 12768
mRNA Refseq NM_009912
Protein Refseq NP_034042

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccr1 Products

Required fields are marked with *

My Review for All Ccr1 Products

Required fields are marked with *

0
cart-icon