Recombinant Mouse Cd3e protein(23-108aa), His&Myc-tagged
Cat.No. : | Cd3e-2911M |
Product Overview : | Recombinant Mouse Cd3e protein(P22646)(23-108aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 23-108aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD |
Gene Name | Cd3e CD3 antigen, epsilon polypeptide [ Mus musculus ] |
Official Symbol | Cd3e |
Synonyms | CD3E; CD3 antigen, epsilon polypeptide; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; CD3; T3e; AI504783; CD3epsilon; |
Gene ID | 12501 |
mRNA Refseq | NM_007648 |
Protein Refseq | NP_031674 |
◆ Recombinant Proteins | ||
CD3E-2663H | Recombinant Human CD3E protein, GST-tagged | +Inquiry |
CD3E-390C | Recombinant Cynomolgus CD3E Protein, His-tagged | +Inquiry |
CD3E-3174HF | Recombinant Full Length Human CD3E Protein, GST-tagged | +Inquiry |
CD3E&CD3G-222C | Recombinant Cynomolgus CD3E & CD3G protein, Fc-tagged | +Inquiry |
CD3E&D-308H | Recombinant Human CD3E & CD3D, His & Flag tag " | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd3e Products
Required fields are marked with *
My Review for All Cd3e Products
Required fields are marked with *