Recombinant Mouse Cd3e protein(23-108aa), His&Myc-tagged

Cat.No. : Cd3e-2911M
Product Overview : Recombinant Mouse Cd3e protein(P22646)(23-108aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 23-108aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.3 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Gene Name Cd3e CD3 antigen, epsilon polypeptide [ Mus musculus ]
Official Symbol Cd3e
Synonyms CD3E; CD3 antigen, epsilon polypeptide; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; CD3; T3e; AI504783; CD3epsilon;
Gene ID 12501
mRNA Refseq NM_007648
Protein Refseq NP_031674

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cd3e Products

Required fields are marked with *

My Review for All Cd3e Products

Required fields are marked with *

0
cart-icon