Recombinant Mouse Cd55 Protein, His-tagged
Cat.No. : | Cd55-7191M |
Product Overview : | Recombinant Mouse Cd55 Protein with a His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Tag : | His |
Protein Length : | 35-362 |
Description : | This gene encodes an inhibitor of both the classical and the alternative pathways of complement activation. The encoded preproprotein undergoes post-translational processing to generate a mature polypeptide anchored to the plasma membrane via a glycosylphosphatidylinositol moiety. Erythrocytes from mice deficient in the encoded protein exhibit impaired regulation of complement activation resulting in enhanced complement deposition. Mice lacking the encoded protein exhibit enhanced susceptibility to experimentally induced myasthenia gravis. This gene is located adjacent to a closely related gene on chromosome 1. |
Form : | Liquid |
Molecular Mass : | 36.8 kDa |
AA Sequence : | DCGPPPDIPNARPILGRHSKFAEQSKVAYSCNNGFKQVPDKSNIVVCLENGQWSSHETFCEKSCVAPERLSFASLKKEYLNMNFFPVGTIVEYECRPGFRKQPPLPGKATCLEDLVWSPVAQFCKKKSCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGVSSTFCSVTGNTVDWDDEFPVCTEIHCPEPPKINNGIMRGESDSYTYSQVVTYSCDKGFILVGNASIYCTVSKSDVGQWSSPPPRCIEKSKVPTKKPTINVPSTGTPSTPQKPTTESVPNPGDQPTPQKPSTVKVSATQHVPVTKTTVRHPIRTSTDKGEPNTGLEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Cd55 CD55 molecule, decay accelerating factor for complement [ Mus musculus (house mouse) ] |
Official Symbol | Cd55 |
Synonyms | Cd55; CD55 molecule, decay accelerating factor for complement; Daf; Daf-; Daf1; GPI-; Daf-GPI; GPI-DAF; complement decay-accelerating factor, GPI-anchored; CD55 antigen; Cromer blood group; GPI anchor addition signal; complement-glycosylphosphatidylinositol; decay accelerating factor 1 |
Gene ID | 13136 |
mRNA Refseq | NM_010016 |
Protein Refseq | NP_034146 |
UniProt ID | Q61475 |
◆ Recombinant Proteins | ||
CD55-64HAF488 | Recombinant Human CD55 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD55-2590H | Recombinant Human CD55 protein(231-350 aa), C-His-tagged | +Inquiry |
Cd55-695M | Recombinant Mouse Cd55 Protein, His-tagged | +Inquiry |
CD55-64HA | Recombinant Human CD55 protein, Fc-tagged, APC labeled | +Inquiry |
Cd55-57M | Recombinant Mouse Cd55 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD55-1669MCL | Recombinant Mouse CD55 cell lysate | +Inquiry |
CD55-1433RCL | Recombinant Rat CD55 cell lysate | +Inquiry |
CD55-2531HCL | Recombinant Human CD55 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd55 Products
Required fields are marked with *
My Review for All Cd55 Products
Required fields are marked with *