Recombinant Mouse CELA2A Protein (31-271 aa), His-tagged

Cat.No. : CELA2A-1358M
Product Overview : Recombinant Mouse CELA2A Protein (31-271 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 31-271 aa
Description : Acts upon elastin.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 27.7 kDa
AA Sequence : VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name Cela2a chymotrypsin-like elastase family, member 2A [ Mus musculus (house mouse) ]
Official Symbol CELA2A
Synonyms Ela2; Ela-2; Ela2a;
Gene ID 13706
mRNA Refseq NM_007919
Protein Refseq NP_031945
UniProt ID P05208

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CELA2A Products

Required fields are marked with *

My Review for All CELA2A Products

Required fields are marked with *

0
cart-icon
0
compare icon