Recombinant Mouse CELA2A Protein (31-271 aa), His-tagged
Cat.No. : | CELA2A-1358M |
Product Overview : | Recombinant Mouse CELA2A Protein (31-271 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 31-271 aa |
Description : | Acts upon elastin. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.7 kDa |
AA Sequence : | VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Cela2a chymotrypsin-like elastase family, member 2A [ Mus musculus (house mouse) ] |
Official Symbol | CELA2A |
Synonyms | Ela2; Ela-2; Ela2a; |
Gene ID | 13706 |
mRNA Refseq | NM_007919 |
Protein Refseq | NP_031945 |
UniProt ID | P05208 |
◆ Recombinant Proteins | ||
CELA2A-1358M | Recombinant Mouse CELA2A Protein (31-271 aa), His-tagged | +Inquiry |
CELA2A-3257C | Recombinant Chicken CELA2A | +Inquiry |
CELA2A-1357H | Recombinant Human CELA2A Protein (29-269 aa), His-tagged | +Inquiry |
CELA2A-1329R | Recombinant Rat CELA2A Protein | +Inquiry |
Cela2a-1161M | Recombinant Mouse Cela2a protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CELA2A-7594HCL | Recombinant Human CELA2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CELA2A Products
Required fields are marked with *
My Review for All CELA2A Products
Required fields are marked with *