Recombinant Mouse CELA2A Protein (31-271 aa), His-tagged

• Cat.No.: CELA2A-1358M
• Product Overview: Recombinant Mouse CELA2A Protein (31-271 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 31-271 aa
• Description: Acts upon elastin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.7 kDa
• AA Sequence: VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Cela2a chymotrypsin-like elastase family, member 2A [ Mus musculus (house mouse) ]
• Official Symbol: CELA2A
• Synonyms: Ela2; Ela-2; Ela2a
• Gene ID: 13706
• mRNA Refseq: NM_007919
• Protein Refseq: NP_031945
• UniProt ID: P05208