Recombinant Mouse Cldn18 protein, His/SUMO-tagged

Cat.No. : Cldn18-35M
Product Overview : Recombinant Mouse Cldn18(1-264 aa) fused with His/SUMO tag was expressed in E.coli cell free.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 1-264 aa
Description : This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is a downstream target gene regulated by the T/EBP/NKX2.1 homeodomain transcription factor. Four alternatively spliced transcript variants resulted from alternative promoters and alternative splicing have been identified, which encode two lung-specific isoforms and two stomach-specific isoforms respectively. This gene is also expressed in colons, inner ear and skin, and its expression is increased in both experimental colitis and ulcerative colitis.
Form : Tris-based buffer,50% glycerol
AA Sequence : MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF TECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLT SGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFV GWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVAYRPGGFKASTGFGSNTRN KKIYDGGARTEDDEQSHPTKYDYV
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week.
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigradeor -80 centigrade.
Gene Name Cldn18 claudin 18 [ Mus musculus ]
Official Symbol Cldn18
Synonyms claudin-18
Gene ID 56492
mRNA Refseq NM_001194921
Protein Refseq NP_001181850
UniProt ID P56857
Chromosome Location 9; 9 E3-F1
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Tight junction, conserved biosystem
Function protein binding; structural molecule activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cldn18 Products

Required fields are marked with *

My Review for All Cldn18 Products

Required fields are marked with *

0
cart-icon