Recombinant Mouse Cldn18 protein, His/SUMO-tagged
Cat.No. : | Cldn18-35M |
Product Overview : | Recombinant Mouse Cldn18(1-264 aa) fused with His/SUMO tag was expressed in E.coli cell free. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-264 aa |
Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is a downstream target gene regulated by the T/EBP/NKX2.1 homeodomain transcription factor. Four alternatively spliced transcript variants resulted from alternative promoters and alternative splicing have been identified, which encode two lung-specific isoforms and two stomach-specific isoforms respectively. This gene is also expressed in colons, inner ear and skin, and its expression is increased in both experimental colitis and ulcerative colitis. |
Form : | Tris-based buffer,50% glycerol |
AA Sequence : | MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF TECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLT SGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFV GWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVAYRPGGFKASTGFGSNTRN KKIYDGGARTEDDEQSHPTKYDYV |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigradeor -80 centigrade. |
Gene Name | Cldn18 claudin 18 [ Mus musculus ] |
Official Symbol | Cldn18 |
Synonyms | claudin-18 |
Gene ID | 56492 |
mRNA Refseq | NM_001194921 |
Protein Refseq | NP_001181850 |
UniProt ID | P56857 |
Chromosome Location | 9; 9 E3-F1 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Tight junction, conserved biosystem |
Function | protein binding; structural molecule activity |
◆ Recombinant Proteins | ||
RFL11404MF | Recombinant Full Length Macaca Fascicularis Claudin(Cldn18)-Vlps (Active) Protein, His-Tagged | +Inquiry |
CLDN18-4433H | Recombinant Human CLDN18 Full Length Transmembrane protein(VLPs), FITC labeled | +Inquiry |
CLDN18-692HF | Recombinant Full Length Human CLDN18 Protein, GST-tagged | +Inquiry |
Cldn18-019M | Active Recombinant Mouse Cldn18 Full Length Transmembrane protein, His-tagged | +Inquiry |
CLDN18-3529M | Recombinant Mouse CLDN18 Protein | +Inquiry |
◆ Native Proteins | ||
CLDN18-33H | Active Recombinant Full Length Human CLDN18 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cldn18 Products
Required fields are marked with *
My Review for All Cldn18 Products
Required fields are marked with *