Recombinant Mouse CNRIP1 Protein (1-464 aa), His-Myc-tagged
Cat.No. : | CNRIP1-2629M |
Product Overview : | Recombinant Mouse CNRIP1 Protein (1-464 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yeast |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 1-464 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.6 kDa |
AA Sequence : | MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Cnrip1 cannabinoid receptor interacting protein 1 [ Mus musculus ] |
Official Symbol | CNRIP1 |
Synonyms | CNRIP1; CRIP-1; C2orf32; AI854501; RP23-348N2.3; 1500041B16Rik; 3110054C06Rik; 5330437A18Rik; |
Gene ID | 380686 |
mRNA Refseq | NM_029861 |
Protein Refseq | NP_084137 |
UniProt ID | Q5M8N0 |
◆ Recombinant Proteins | ||
CNRIP1-1837H | Recombinant Human CNRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CNRIP1-4919C | Recombinant Chicken CNRIP1 | +Inquiry |
CNRIP1-1156R | Recombinant Rat CNRIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNRIP1-3679M | Recombinant Mouse CNRIP1 Protein | +Inquiry |
CNRIP1-773R | Recombinant Rhesus Macaque CNRIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNRIP1-7393HCL | Recombinant Human CNRIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNRIP1 Products
Required fields are marked with *
My Review for All CNRIP1 Products
Required fields are marked with *