Recombinant Mouse CNRIP1 Protein (1-464 aa), His-Myc-tagged

• Cat.No.: CNRIP1-2629M
• Product Overview: Recombinant Mouse CNRIP1 Protein (1-464 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Full Length.

Specification

• Species: Yeast
• Source: Yeast
• Tag: His&Myc
• Protein Length: 1-464 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.6 kDa
• AA Sequence: MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Cnrip1 cannabinoid receptor interacting protein 1 [ Mus musculus ]
• Official Symbol: CNRIP1
• Synonyms: CNRIP1; CRIP-1; C2orf32; AI854501; RP23-348N2.3; 1500041B16Rik; 3110054C06Rik; 5330437A18Rik
• Gene ID: 380686
• mRNA Refseq: NM_029861
• Protein Refseq: NP_084137
• UniProt ID: Q5M8N0