Recombinant Mouse Cr2 protein, His-tagged
Cat.No. : | Cr2-2727M |
Product Overview : | Recombinant Mouse Cr2 protein(P19070)(729-963aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 729-963aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30 kDa |
AA Sequence : | LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cr2 complement receptor 2 [ Mus musculus ] |
Official Symbol | Cr2 |
Synonyms | CR2; complement receptor 2; complement receptor type 2; complement C3d receptor; complement receptor type 1; expressed in B lymphocytes; Cr1; C3DR; CD21; CD35; Cr-1; Cr-2; MGC130295; |
Gene ID | 12902 |
mRNA Refseq | NM_007758 |
Protein Refseq | NP_031784 |
◆ Recombinant Proteins | ||
CR2-283H | Recombinant Human CR2, StrepII-tagged | +Inquiry |
Cr2-5002M | Recombinant Mouse Cr2 protein, His-tagged | +Inquiry |
Cr2-5383M | Recombinant Mouse Cr2 protein, His-tagged | +Inquiry |
Cr2-2728M | Recombinant Mouse Cr2 protein, His-tagged | +Inquiry |
CR2-3334H | Recombinant Human CR2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CR2-2201HCL | Recombinant Human CR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cr2 Products
Required fields are marked with *
My Review for All Cr2 Products
Required fields are marked with *
0
Inquiry Basket