Recombinant Mouse Cr2 protein, His-tagged
| Cat.No. : | Cr2-2728M |
| Product Overview : | Recombinant Mouse Cr2 protein(P19070)(12-140aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 12-140aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.1 kDa |
| AA Sequence : | ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCES |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Cr2 complement receptor 2 [ Mus musculus ] |
| Official Symbol | Cr2 |
| Synonyms | CR2; complement receptor 2; complement receptor type 2; complement C3d receptor; complement receptor type 1; expressed in B lymphocytes; Cr1; C3DR; CD21; CD35; Cr-1; Cr-2; MGC130295; |
| Gene ID | 12902 |
| mRNA Refseq | NM_007758 |
| Protein Refseq | NP_031784 |
| ◆ Recombinant Proteins | ||
| Cr2-838R | Recombinant Rat Cr2 protein, His & T7-tagged | +Inquiry |
| CR2-237H | Recombinant Human CR2, StrepII-tagged | +Inquiry |
| Cr2-938M | Recombinant Mouse Cr2 Protein, MYC/DDK-tagged | +Inquiry |
| Cr2-5383M | Recombinant Mouse Cr2 protein, His-tagged | +Inquiry |
| CR2-3334H | Recombinant Human CR2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CR2-2201HCL | Recombinant Human CR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cr2 Products
Required fields are marked with *
My Review for All Cr2 Products
Required fields are marked with *
