"Crlf2" Related Products

Expand
Expand

Recombinant Mouse Crlf2 protein, His-tagged

Cat.No.: Crlf2-452M
Product Overview: Recombinant Mouse Crlf2(Ala20-Leu233) fused with His tag at C-terminal was expressed in HEK293.
Description: The cytokine thymic stromal lymphopoietin receptor (TSLPR) is consisting of a common γ receptor–like chain (TSLPR-γ) and a common interleukin 7 (IL-7) Rα chain that belongs to the type 1 cytokine receptor family. Transfection of TSLPR cDNA result in only low affinity binding, while cotransfection of the IL-7Rα chain cDNA shows high affinity binding. TSLP and TSLPR play a critical role in the initiation of allergic diseases in mice. The TSLP R cDNA encodes a transmembrane receptor containing 370 amino acids (aa) with two potential N-linked glycosylation sites and a cytoplasmic domain of 104 aa including a single tyrosine residue. TSLPR can mediate signaling of the signal transducer and activator of transcription 5 (Stat5) by TSLP. TSLP R is broadly expressed in the immune and hematopoietic cells, particularly in hematopoietic progenitors and myeloid cells.
Source: HEK293
Species: Mouse
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Protein length: Ala20-Leu233
AA Sequence: AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCIL PAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEV QHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAA SAASCTASPAPSPALAPPLVDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: Crlf2 cytokine receptor-like factor 2 [ Mus musculus ]
Official Symbol: Crlf2
Synonyms: CRLF2; cytokine receptor-like factor 2; CRLM-2; delta 1; TSLP receptor; lymphocyte antigen 114; type I cytokine receptor delta 1; cytokine receptor-like molecule 2; thymic stromal lymphopoietin protein receptor; thymic stromal-derived lymphopoietin, receptor; transmembrane phosphoinositide 3-phosphatase and tensin homolog 2; CRLM2; Ly114; Tpte2; Tslpr;
Gene ID: 57914
mRNA Refseq: NM_001164735
Protein Refseq: NP_001158207
MIM:
UniProt ID: Q8CII9
Chromosome Location: 5; 5 F
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function: cytokine activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.