Recombinant Mouse Crlf2 protein, His-tagged
Cat.No. : | Crlf2-452M |
Product Overview : | Recombinant Mouse Crlf2(Ala20-Leu233) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | Ala20-Leu233 |
Description : | The cytokine thymic stromal lymphopoietin receptor (TSLPR) is consisting of a common γ receptor–like chain (TSLPR-γ) and a common interleukin 7 (IL-7) Rα chain that belongs to the type 1 cytokine receptor family. Transfection of TSLPR cDNA result in only low affinity binding, while cotransfection of the IL-7Rα chain cDNA shows high affinity binding. TSLP and TSLPR play a critical role in the initiation of allergic diseases in mice. The TSLP R cDNA encodes a transmembrane receptor containing 370 amino acids (aa) with two potential N-linked glycosylation sites and a cytoplasmic domain of 104 aa including a single tyrosine residue. TSLPR can mediate signaling of the signal transducer and activator of transcription 5 (Stat5) by TSLP. TSLP R is broadly expressed in the immune and hematopoietic cells, particularly in hematopoietic progenitors and myeloid cells. |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
AA Sequence : | AAAVTSRGDVTVVCHDLETVEVTWGSGPDHHSANLSLEFRYGTGALQPCPRYFLSGAGVTSGCIL PAARAGLLELALRDGGGAMVFKARQRASAWLKPRPPWNVTLLWTPDGDVTVSWPAHSYLGLDYEV QHRESNDDEDAWQTTSGPCCDLTVGGLDPARCYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAA SAASCTASPAPSPALAPPLVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | Crlf2 cytokine receptor-like factor 2 [ Mus musculus ] |
Official Symbol | Crlf2 |
Synonyms | CRLF2; cytokine receptor-like factor 2; CRLM-2; delta 1; TSLP receptor; lymphocyte antigen 114; type I cytokine receptor delta 1; cytokine receptor-like molecule 2; thymic stromal lymphopoietin protein receptor; thymic stromal-derived lymphopoietin, receptor; transmembrane phosphoinositide 3-phosphatase and tensin homolog 2; CRLM2; Ly114; Tpte2; Tslpr; |
Gene ID | 57914 |
mRNA Refseq | NM_001164735 |
Protein Refseq | NP_001158207 |
MIM | |
UniProt ID | Q8CII9 |
Chromosome Location | 5; 5 F |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | cytokine activity; receptor activity; |
◆ Recombinant Proteins | ||
CRLF2-7424Z | Recombinant Zebrafish CRLF2 | +Inquiry |
Crlf2-6614M | Recombinant Mouse Crlf2 Protein, Myc/DDK-tagged | +Inquiry |
CRLF2-76H | Active Recombinant Human CRLF2, Fc-tagged | +Inquiry |
CRLF2-1986M | Recombinant Mouse CRLF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRLF2-051H | Active Recombinant Human CRLF2 protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRLF2-7275HCL | Recombinant Human CRLF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Crlf2 Products
Required fields are marked with *
My Review for All Crlf2 Products
Required fields are marked with *
0
Inquiry Basket