Recombinant Mouse Cryaa Protein

Cat.No. : Cryaa-7175M
Product Overview : Recombinant mouse Crystallin alpha A / CRYAA protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 1-175
Description : This gene encodes subunit a, one of two subunits of alpha-crystallin, which is a high molecular weight, soluble aggregate and is a member of the small heat shock protein (sHSP) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. It acts as a molecular chaperone and is the major protein in the eye lens, maintaining the transparency and refractive index of the lens. In mouse, deficiency in this gene is associated with smaller lenses and eyes and with increasing lens opacity with age. Alternative splicing results in multiple transcript variants.
Form : Liquid
Molecular Mass : 20 kDa
AA Sequence : MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVAAAPKK
Purity : > 95 % > 95 % by SDS PAGE
Stability : Shelf life: one year from despatch.
Storage : Store (in aliquots) at -20 centigrade. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL
Storage Buffer : 20 mM Tris pH 8.0 and 10 % glycerol
Gene Name Cryaa crystallin, alpha A [ Mus musculus (house mouse) ]
Official Symbol Cryaa
Synonyms Cryaa; crystallin, alpha A; Cry; Acry; Crya; Crya1; DAcry; lop18; Acry-1; Crya-1; DAcry-1; alpha-crystallin A chain; crystallin, alpha 1; lens opacity 18
Gene ID 12954
mRNA Refseq NM_001278569
Protein Refseq NP_001265498
UniProt ID Q569M7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cryaa Products

Required fields are marked with *

My Review for All Cryaa Products

Required fields are marked with *

0
cart-icon
0
compare icon