Recombinant Mouse Cryaa Protein
| Cat.No. : | Cryaa-7175M |
| Product Overview : | Recombinant mouse Crystallin alpha A / CRYAA protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Protein Length : | 1-175 |
| Description : | This gene encodes subunit a, one of two subunits of alpha-crystallin, which is a high molecular weight, soluble aggregate and is a member of the small heat shock protein (sHSP) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. It acts as a molecular chaperone and is the major protein in the eye lens, maintaining the transparency and refractive index of the lens. In mouse, deficiency in this gene is associated with smaller lenses and eyes and with increasing lens opacity with age. Alternative splicing results in multiple transcript variants. |
| Form : | Liquid |
| Molecular Mass : | 20 kDa |
| AA Sequence : | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVAAAPKK |
| Purity : | > 95 % > 95 % by SDS PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store (in aliquots) at -20 centigrade. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL |
| Storage Buffer : | 20 mM Tris pH 8.0 and 10 % glycerol |
| Gene Name | Cryaa crystallin, alpha A [ Mus musculus (house mouse) ] |
| Official Symbol | Cryaa |
| Synonyms | Cryaa; crystallin, alpha A; Cry; Acry; Crya; Crya1; DAcry; lop18; Acry-1; Crya-1; DAcry-1; alpha-crystallin A chain; crystallin, alpha 1; lens opacity 18 |
| Gene ID | 12954 |
| mRNA Refseq | NM_001278569 |
| Protein Refseq | NP_001265498 |
| UniProt ID | Q569M7 |
| ◆ Recombinant Proteins | ||
| CRYAA-2127HF | Recombinant Full Length Human CRYAA Protein, GST-tagged | +Inquiry |
| CRYAA-667H | Recombinant Human CRYAA Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRYAA-7877H | Recombinant Human CRYAA protein, GST-tagged | +Inquiry |
| CRYAA-3933M | Recombinant Mouse CRYAA Protein | +Inquiry |
| CRYAA-850H | Recombinant Human CRYAA Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRYAA-7267HCL | Recombinant Human CRYAA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cryaa Products
Required fields are marked with *
My Review for All Cryaa Products
Required fields are marked with *
