Recombinant Mouse Csf3 protein

Cat.No. : Csf3-100M
Product Overview : Recombinant Mouse Csf3 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 178
Description : The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 10 mM Sodium Citrate, pH 4.0, 150 mM NaCl, 0.01 % Tween-20.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg.
Molecular Mass : Approximately 18.9 kDa, a single non-glycosylated polypeptide chain containing 178 amino acids.
AA Sequence : VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Endotoxin : Less than 0.1 EU/μg of rMuG-CSF as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Csf3
Official Symbol Csf3
Synonyms CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; Csfg; G-CSF; MGI-IG;
Gene ID 12985
mRNA Refseq NM_009971
Protein Refseq NP_034101
UniProt ID P09920

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Csf3 Products

Required fields are marked with *

My Review for All Csf3 Products

Required fields are marked with *

0
cart-icon