Recombinant Mouse Cst7 protein, His-tagged

Cat.No. : Cst7-930M
Product Overview : Recombinant Mouse Cst7(Ala19-Gln144) fused with His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : Ala19-Gln144
Description : Mouse Cystatin F belongs to cystatin superfamily, which encompasses proteins that contain multiple cystatin-like sequences. It has been shown that Cystatin F is selectively expressed by hematopoietic cells and may be a biomarker for both liver metastasis and inflammatory lung disorders. Mouse Cystatin F inhibits papain and cathepsin L but with affinities lower than other cystatins. It may play a role in immune regulation through inhibition of a unique target in the hematopoietic system.
Form : Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.
AA Sequence : ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVK GLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQVDHH HHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Shipping : The product is shipped on dry ice/ice packs.
Gene Name Cst7 cystatin F (leukocystatin) [ Mus musculus ]
Official Symbol cst7
Synonyms CST7; cystatin F (leukocystatin); cystatin-F; cystatin 7; cystatin-7; cystatin-like metastasis-associated protein; Cmap; MGC151424; MGC151426;
Gene ID 13011
mRNA Refseq NM_009977
Protein Refseq NP_034107
UniProt ID O89098
Chromosome Location 2; 2 G1-G3
Function cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cst7 Products

Required fields are marked with *

My Review for All Cst7 Products

Required fields are marked with *

0
cart-icon
0
compare icon