Recombinant Mouse Cst7 protein, His-tagged
| Cat.No. : | Cst7-930M |
| Product Overview : | Recombinant Mouse Cst7(Ala19-Gln144) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Ala19-Gln144 |
| Description : | Mouse Cystatin F belongs to cystatin superfamily, which encompasses proteins that contain multiple cystatin-like sequences. It has been shown that Cystatin F is selectively expressed by hematopoietic cells and may be a biomarker for both liver metastasis and inflammatory lung disorders. Mouse Cystatin F inhibits papain and cathepsin L but with affinities lower than other cystatins. It may play a role in immune regulation through inhibition of a unique target in the hematopoietic system. |
| Form : | Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0. |
| AA Sequence : | ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVK GLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQVDHH HHHH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| Shipping : | The product is shipped on dry ice/ice packs. |
| Gene Name | Cst7 cystatin F (leukocystatin) [ Mus musculus ] |
| Official Symbol | cst7 |
| Synonyms | CST7; cystatin F (leukocystatin); cystatin-F; cystatin 7; cystatin-7; cystatin-like metastasis-associated protein; Cmap; MGC151424; MGC151426; |
| Gene ID | 13011 |
| mRNA Refseq | NM_009977 |
| Protein Refseq | NP_034107 |
| UniProt ID | O89098 |
| Chromosome Location | 2; 2 G1-G3 |
| Function | cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity; |
| ◆ Recombinant Proteins | ||
| CST7-2240HF | Recombinant Full Length Human CST7 Protein, GST-tagged | +Inquiry |
| CST7-2746H | Recombinant Human CST7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CST7-2031H | Recombinant Human CST7 Protein, GST-tagged | +Inquiry |
| CST7-1047H | Active Recombinant Human CST7 Protein, His-tagged | +Inquiry |
| Cst7-1061M | Active Recombinant Mouse Cst7 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CST7-1522MCL | Recombinant Mouse CST7 cell lysate | +Inquiry |
| CST7-2472HCL | Recombinant Human CST7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cst7 Products
Required fields are marked with *
My Review for All Cst7 Products
Required fields are marked with *
