"Cst7" Related Products

Expand
Expand

Recombinant Mouse Cst7 protein, His-tagged

Cat.No.: Cst7-930M
Product Overview: Recombinant Mouse Cst7(Ala19-Gln144) fused with His tag at C-terminal was expressed in HEK293.
Description: Mouse Cystatin F belongs to cystatin superfamily, which encompasses proteins that contain multiple cystatin-like sequences. It has been shown that Cystatin F is selectively expressed by hematopoietic cells and may be a biomarker for both liver metastasis and inflammatory lung disorders. Mouse Cystatin F inhibits papain and cathepsin L but with affinities lower than other cystatins. It may play a role in immune regulation through inhibition of a unique target in the hematopoietic system.
Source: HEK293
Species: Mouse
Tag : His
Form: Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.
Protein length: Ala19-Gln144
AA Sequence: ARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVK GLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQVDHH HHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Shipping: The product is shipped on dry ice/ice packs.
Gene Name: Cst7 cystatin F (leukocystatin) [ Mus musculus ]
Official Symbol: cst7
Synonyms: CST7; cystatin F (leukocystatin); cystatin-F; cystatin 7; cystatin-7; cystatin-like metastasis-associated protein; Cmap; MGC151424; MGC151426;
Gene ID: 13011
mRNA Refseq: NM_009977
Protein Refseq: NP_034107
UniProt ID: O89098
Chromosome Location: 2; 2 G1-G3
Function: cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.