Recombinant Mouse Ctsa Protein, His-tagged

• Cat.No.: Ctsa-7309M
• Product Overview: Recombinant Mouse Ctsa Protein with a His tag.

Specification

• Species: Mouse
• Tag: His
• Protein Length: 24-474
• Description: This gene encodes a glycoprotein with deamidase, esterase and carboxypeptidase activities. The encoded protein associates with and provides a protective function to the lysosomal enzymes beta-galactosidase and neuraminidase. Deficiency of the related gene in humans results in galactosialidosis. The proprotein is processed into two shorter chains. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Form: Liquid
• Molecular Mass: 52.4 kDa
• AA Sequence: APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPYVEHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Ctsa cathepsin A [ Mus musculus (house mouse) ]
• Official Symbol: Ctsa
• Synonyms: Ctsa; cathepsin A; P; Pp; PPCA; Ppgb; AU019505; lysosomal protective protein; carboxypeptidase C; carboxypeptidase L; protective protein cathepsin A; protective protein for beta-galactosidase; EC 3.4.16.5
• Gene ID: 19025
• mRNA Refseq: NM_001038492
• Protein Refseq: NP_001033581
• UniProt ID: P16675