Recombinant Mouse Ctsa Protein, His-tagged

Cat.No. : Ctsa-7309M
Product Overview : Recombinant Mouse Ctsa Protein with a His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Tag : His
Protein Length : 24-474
Description : This gene encodes a glycoprotein with deamidase, esterase and carboxypeptidase activities. The encoded protein associates with and provides a protective function to the lysosomal enzymes beta-galactosidase and neuraminidase. Deficiency of the related gene in humans results in galactosialidosis. The proprotein is processed into two shorter chains. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Form : Liquid
Molecular Mass : 52.4 kDa
AA Sequence : APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPYVEHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Ctsa cathepsin A [ Mus musculus (house mouse) ]
Official Symbol Ctsa
Synonyms Ctsa; cathepsin A; P; Pp; PPCA; Ppgb; AU019505; lysosomal protective protein; carboxypeptidase C; carboxypeptidase L; protective protein cathepsin A; protective protein for beta-galactosidase; EC 3.4.16.5
Gene ID 19025
mRNA Refseq NM_001038492
Protein Refseq NP_001033581
UniProt ID P16675

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ctsa Products

Required fields are marked with *

My Review for All Ctsa Products

Required fields are marked with *

0
cart-icon
0
compare icon