Recombinant Mouse Ctsk protein, His-tagged
Cat.No. : | Ctsk-2761M |
Product Overview : | Recombinant Mouse Ctsk protein(P55097)(115-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 115-329aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.4 kDa |
AA Sequence : | VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFPKM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ctsk cathepsin K [ Mus musculus ] |
Official Symbol | Ctsk |
Synonyms | CTSK; cathepsin K; Cat K; minisatellite 10q detected by probe MMS10; catK; Ms10q; MMS10-Q; AI323530; |
Gene ID | 13038 |
mRNA Refseq | NM_007802 |
Protein Refseq | NP_031828 |
◆ Recombinant Proteins | ||
CTSK-2354HF | Recombinant Full Length Human CTSK Protein, GST-tagged | +Inquiry |
CTSK-328D | Recombinant Dog CTSK Protein, His/GST-tagged | +Inquiry |
CTSK-2111H | Recombinant Human CTSK Protein, GST-tagged | +Inquiry |
CTSK-22H | Active Recombinant Human Procathepsin K Protein | +Inquiry |
CTSK-329H | Recombinant Human CTSK Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSK-7192HCL | Recombinant Human CTSK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ctsk Products
Required fields are marked with *
My Review for All Ctsk Products
Required fields are marked with *
0
Inquiry Basket