Recombinant Mouse Ctsl protein, His & Myc-tagged
Cat.No. : | Ctsl-2764M |
Product Overview : | Recombinant Mouse Ctsl protein(P06797)(114-288aa), fused to N-terminal His tagand C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 114-288aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.2 kDa |
AA Sequence : | IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
Ctsl-1129M | Recombinant Mouse Cathepsin L, His-tagged | +Inquiry |
CTSL-54H | Recombinant Human CTSL, His-tagged | +Inquiry |
CTSL-421H | Recombinant Human CTSL Protein, His-tagged | +Inquiry |
CTSL-2113H | Recombinant Human CTSL Protein, GST-tagged | +Inquiry |
CTSL-423P | Recombinant Pig CTSL Protein, His/GST-tagged | +Inquiry |
◆ Native Proteins | ||
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSL1-1867MCL | Recombinant Mouse CTSL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctsl Products
Required fields are marked with *
My Review for All Ctsl Products
Required fields are marked with *