Recombinant Mouse ctss protein, His-tagged
Cat.No. : | ctss-2767M |
Product Overview : | Recombinant Mouse ctss protein(O70370)(123-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 123-340aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.7 kDa |
AA Sequence : | LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Ctss cathepsin S [ Mus musculus ] |
Official Symbol | ctss |
Synonyms | CTSS; cathepsin S; Cat S; |
Gene ID | 13040 |
mRNA Refseq | NM_021281 |
Protein Refseq | NP_067256 |
◆ Recombinant Proteins | ||
CTSS-7251H | Recombinant Human CTSS, His-tagged | +Inquiry |
CTSS-2695H | Active Recombinant Human CTSS protein, His-tagged | +Inquiry |
Ctss-1985M | Recombinant Mouse Ctss protein, His-tagged | +Inquiry |
CTSS-2363HF | Recombinant Full Length Human CTSS Protein, GST-tagged | +Inquiry |
CTSS-283H | Recombinant Human CTSS Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CTSS-27405TH | Native Human CTSS | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSS-1563MCL | Recombinant Mouse CTSS cell lysate | +Inquiry |
CTSS-3021HCL | Recombinant Human CTSS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ctss Products
Required fields are marked with *
My Review for All ctss Products
Required fields are marked with *
0
Inquiry Basket