Recombinant Mouse ctss protein, His-tagged
| Cat.No. : | ctss-2767M |
| Product Overview : | Recombinant Mouse ctss protein(O70370)(123-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 123-340aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.7 kDa |
| AA Sequence : | LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Ctss cathepsin S [ Mus musculus ] |
| Official Symbol | ctss |
| Synonyms | CTSS; cathepsin S; Cat S; |
| Gene ID | 13040 |
| mRNA Refseq | NM_021281 |
| Protein Refseq | NP_067256 |
| ◆ Recombinant Proteins | ||
| Ctss-1293R | Recombinant Rat Ctss Protein, His-tagged | +Inquiry |
| Ctss-69M | Recombinant Mouse Ctss Protein, His-tagged | +Inquiry |
| CTSS-2999C | Recombinant Chicken CTSS | +Inquiry |
| CTSS-1893H | Recombinant Human CTSS Protein (Leu115-Ile331), His tagged | +Inquiry |
| CTSS-1984C | Recombinant Cattle CTSS protein, His & T7-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSS-27405TH | Native Human CTSS | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSS-3021HCL | Recombinant Human CTSS cell lysate | +Inquiry |
| CTSS-1563MCL | Recombinant Mouse CTSS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ctss Products
Required fields are marked with *
My Review for All ctss Products
Required fields are marked with *



