Active Recombinant Mouse Cxcl15 Protein

Cat.No. : Cxcl15-136M
Product Overview : Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 15 (Cxcl15) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Chemotactic for neutrophils. Involved in lung-specific neutrophil trafficking during normal and inflammatory conditions.
Bio-activity : Determined by its ability to chemoattract human neutrophils using a concentration range of 20.0-100.0 ng/ml.
Molecular Mass : 16.3 kDa
AA Sequence : QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Cxcl15 chemokine (C-X-C motif) ligand 15 [ Mus musculus (house mouse) ]
Official Symbol Cxcl15
Synonyms Cxcl15; chemokine (C-X-C motif) ligand 15; Il8; weche; Scyb15; lungkine; C-X-C motif chemokine 15; interleukin 8; small inducible cytokine subfamily B, member 15; small-inducible cytokine B15
Gene ID 20309
mRNA Refseq NM_011339
Protein Refseq NP_035469
UniProt ID Q9WVL7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl15 Products

Required fields are marked with *

My Review for All Cxcl15 Products

Required fields are marked with *

0
cart-icon