Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
142 |
Description : |
Mouse Lungkine/CXCL15, also named WECHE, is a member of the ELR motif-containing CXC chemokines. The cDNA of mouse Lungkine encodes a protein of 166 amino acids (aa) with a 25 aa predicted signal peptide and a 141 aa mature protein with an extremely long C terminal tail that protrudes beyond the chemokine fold. Mouse Lungkine shares 35% aa sequence identity with human ENA-78 and 31% identity with human IL-8. The gene for mouse Lungkine has been mapped to chromosome 5. By Northern blot and in situ hybridization, Lungkine transcripts are only specifically detected in the adult and fetal lung, and its expression is up-regulated under inflammatory conditions. Lungkine protein is secreted into bronchoalveolar space and is involved in lung-specific neutrophils trafficking. Studies from Lungkine knock out mice suggests that Lungkine is an important mediator of neutrophil migration from the lung parenchyma into the airspace. Lungkine is also chemotactic for bone marrow progenitor cells and modulates hematopoietic cell differentiation. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 0.02 % Tween-20. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration of 20-100 ng/ml. |
Molecular Mass : |
Approximately 16.4 kDa, a single non-glycosylated polypeptide chain containing 142 amino acids. |
AA Sequence : |
QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA |
Endotoxin : |
Less than 1 EU/µg of rMuLungkine/CXCL15 as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |