Recombinant Mouse Cxcl15 protein, His&Myc-tagged
| Cat.No. : | Cxcl15-533M |
| Product Overview : | Recombinant Mouse Cxcl15 protein(Q9WVL7)(26-167aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 26-167aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA |
| Gene Name | Cxcl15 chemokine (C-X-C motif) ligand 15 [ Mus musculus ] |
| Official Symbol | Cxcl15 |
| Synonyms | CXCL15; chemokine (C-X-C motif) ligand 15; C-X-C motif chemokine 15; small-inducible cytokine B15; small inducible cytokine subfamily B, member 15; weche; Scyb15; lungkine; |
| Gene ID | 20309 |
| mRNA Refseq | NM_011339 |
| Protein Refseq | NP_035469 |
| ◆ Recombinant Proteins | ||
| Cxcl15-200M | Recombinant Mouse Cxcl15 Protein, His-tagged | +Inquiry |
| Cxcl15-99M | Recombinant Mouse Cxcl15 protein | +Inquiry |
| CXCL15-2706H | Recombinant Hamster CXCL15 Protein, His&GST-tagged | +Inquiry |
| Cxcl15-5745M | Recombinant Mouse Cxcl15 Protein (Gln26-Ala167), C-His tagged | +Inquiry |
| Cxcl15-533M | Recombinant Mouse Cxcl15 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl15 Products
Required fields are marked with *
My Review for All Cxcl15 Products
Required fields are marked with *
