"DDT" Related Products

Expand
Expand
Expand

Recombinant Mouse DCN Protein (2-118 aa), His-tagged

Cat.No. : DDT-1378M
Product Overview : Recombinant Mouse DCN Protein (2-118 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
Description : Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).
Source : Yeast
Species : Mouse
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.9 kDa
Protein length : 2-118 aa
AA Sequence : PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : Ddt D-dopachrome tautomerase [ Mus musculus ]
Official Symbol : DDT
Synonyms : DDT; D-dopachrome tautomerase; C78655;
Gene ID : 13202
mRNA Refseq : NM_010027
Protein Refseq : NP_034157
UniProt ID : O35215

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.