Recombinant Mouse DCN Protein (35-354 aa), His-SUMO-tagged
| Cat.No. : | DCN-450M |
| Product Overview : | Recombinant Mouse DCN Protein (35-354 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 35-354 aa |
| Description : | May affect the rate of fibrils formation. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 51.9 kDa |
| AA Sequence : | GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | Dcn decorin [ Mus musculus ] |
| Official Symbol | DCN |
| Synonyms | DCN; decorin; DC; PG40; PGII; PGS2; mDcn; DSPG2; SLRR1B; |
| Gene ID | 13179 |
| mRNA Refseq | NM_001190451 |
| Protein Refseq | NP_001177380 |
| UniProt ID | P28654 |
| ◆ Recombinant Proteins | ||
| Dcn-64M | Recombinant Mouse Dcn protein, His-tagged | +Inquiry |
| DCN-1797R | Recombinant Rat DCN Protein | +Inquiry |
| DCN-1455R | Recombinant Rat DCN Protein, His (Fc)-Avi-tagged | +Inquiry |
| DCN-1170H | Recombinant Human DCN Protein, MYC/DDK-tagged | +Inquiry |
| Dcn-5639M | Recombinant Mouse Dcn Protein (Gly17-Lys354), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCN-2274HCL | Recombinant Human DCN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCN Products
Required fields are marked with *
My Review for All DCN Products
Required fields are marked with *
