Recombinant Mouse DDT protein

• Cat.No.: DDT-1378M
• Product Overview: Recombinant Mouse DDT protein(O35215)(2-118aa) was expressed in Yeast.

Specification

• Species: Mouse
• Source: Yeast
• Tag: Non
• Protein Length: 2-118aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 14.9kDa
• AA Sequence: PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Ddt D-dopachrome tautomerase [ Mus musculus (house mouse) ]
• Official Symbol: Ddt
• Synonyms: Ddt; D-dopachrome tautomerase; C78655; D-dopachrome decarboxylase
• Gene ID: 13202
• mRNA Refseq: NM_010027.1
• Protein Refseq: NP_034157.1
• UniProt ID: O35215