Recombinant Mouse DDT protein
| Cat.No. : | DDT-1378M |
| Product Overview : | Recombinant Mouse DDT protein(O35215)(2-118aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | Non |
| Protein Length : | 2-118aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 14.9kDa |
| AA Sequence : | PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Ddt D-dopachrome tautomerase [ Mus musculus (house mouse) ] |
| Official Symbol | Ddt |
| Synonyms | Ddt; D-dopachrome tautomerase; C78655; D-dopachrome decarboxylase |
| Gene ID | 13202 |
| mRNA Refseq | NM_010027.1 |
| Protein Refseq | NP_034157.1 |
| UniProt ID | O35215 |
| ◆ Recombinant Proteins | ||
| Ddt-1370R | Recombinant Rat Ddt protein, His&Myc-tagged | +Inquiry |
| DDT-2371C | Recombinant Chicken DDT | +Inquiry |
| DDT-3434H | Recombinant Human DDT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DDT-1036R | Recombinant Rhesus Macaque DDT Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDT-2260M | Recombinant Mouse DDT Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDT-7022HCL | Recombinant Human DDT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDT Products
Required fields are marked with *
My Review for All DDT Products
Required fields are marked with *
