Recombinant Mouse DDT protein
Cat.No. : | DDT-1378M |
Product Overview : | Recombinant Mouse DDT protein(O35215)(2-118aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | Non |
Protein Length : | 2-118aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 14.9kDa |
AA Sequence : | PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Ddt D-dopachrome tautomerase [ Mus musculus (house mouse) ] |
Official Symbol | Ddt |
Synonyms | Ddt; D-dopachrome tautomerase; C78655; D-dopachrome decarboxylase |
Gene ID | 13202 |
mRNA Refseq | NM_010027.1 |
Protein Refseq | NP_034157.1 |
UniProt ID | O35215 |
◆ Recombinant Proteins | ||
DDT-734H | Recombinant Human D-dopachrome Tautomerase, His-tagged | +Inquiry |
DDT-2460H | Recombinant Human DDT Protein, GST-tagged | +Inquiry |
DDT-1312C | Recombinant Cynomolgus DDT protein, His-tagged | +Inquiry |
Ddt-2498M | Recombinant Mouse Ddt Protein, Myc/DDK-tagged | +Inquiry |
Ddt-01M | Recombinant Mouse DDT Protein (1-118aa), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDT-7022HCL | Recombinant Human DDT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDT Products
Required fields are marked with *
My Review for All DDT Products
Required fields are marked with *
0
Inquiry Basket