Recombinant Mouse DEFB14 Protein (23-67 aa), His-SUMO-tagged
| Cat.No. : | DEFB14-1043M |
| Product Overview : | Recombinant Mouse DEFB14 Protein (23-67 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
| Description : | Has antibacterial activity. |
| Source : | E. coli |
| Species : | Mouse |
| Tag : | His-SUMO |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 21.2 kDa |
| Protein length : | 23-67 aa |
| AA Sequence : | FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name : | Defb14 defensin beta 14 [ Mus musculus (house mouse) ] |
| Official Symbol : | DEFB14 |
| Synonyms : | BD-14; |
| Gene ID : | 244332 |
| mRNA Refseq : | NM_183026 |
| Protein Refseq : | NP_898847 |
| UniProt ID : | Q7TNV9 |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
