Recombinant Mouse DLK2 Protein (27-305 aa), His-tagged

• Cat.No.: DLK2-2334M
• Product Overview: Recombinant Mouse DLK2 Protein (27-305 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 27-305 aa
• Description: Regulates adipogenesis.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.6 kDa
• AA Sequence: DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Dlk2 delta-like 2 homolog (Drosophila) [ Mus musculus ]
• Official Symbol: DLK2
• Synonyms: DLK2; DLK-2; EGF-like protein 9; Egfl9; AI413481
• Gene ID: 106565
• mRNA Refseq: NM_207666
• Protein Refseq: NP_997549
• UniProt ID: Q8K1E3