Recombinant Mouse DLK2 Protein (27-305 aa), His-tagged
| Cat.No. : | DLK2-2334M |
| Product Overview : | Recombinant Mouse DLK2 Protein (27-305 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 27-305 aa |
| Description : | Regulates adipogenesis. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 31.6 kDa |
| AA Sequence : | DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Dlk2 delta-like 2 homolog (Drosophila) [ Mus musculus ] |
| Official Symbol | DLK2 |
| Synonyms | DLK2; DLK-2; EGF-like protein 9; Egfl9; AI413481; |
| Gene ID | 106565 |
| mRNA Refseq | NM_207666 |
| Protein Refseq | NP_997549 |
| UniProt ID | Q8K1E3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLK2 Products
Required fields are marked with *
My Review for All DLK2 Products
Required fields are marked with *
