Recombinant Mouse DLK2 Protein (27-305 aa), His-tagged
Cat.No. : | DLK2-2334M |
Product Overview : | Recombinant Mouse DLK2 Protein (27-305 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 27-305 aa |
Description : | Regulates adipogenesis. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.6 kDa |
AA Sequence : | DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Dlk2 delta-like 2 homolog (Drosophila) [ Mus musculus ] |
Official Symbol | DLK2 |
Synonyms | DLK2; DLK-2; EGF-like protein 9; Egfl9; AI413481; |
Gene ID | 106565 |
mRNA Refseq | NM_207666 |
Protein Refseq | NP_997549 |
UniProt ID | Q8K1E3 |
◆ Recombinant Proteins | ||
DLK2-12024H | Recombinant Human DLK2, His-tagged | +Inquiry |
RFL627SF | Recombinant Full Length Pig Protein Delta Homolog 2(Dlk2) Protein, His-Tagged | +Inquiry |
DLK2-1886R | Recombinant Rat DLK2 Protein | +Inquiry |
DLK2-1044H | Recombinant Human DLK2 Protein (27-306 aa), GST-tagged | +Inquiry |
RFL27811BF | Recombinant Full Length Bovine Protein Delta Homolog 2(Dlk2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLK2-536HCL | Recombinant Human DLK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLK2 Products
Required fields are marked with *
My Review for All DLK2 Products
Required fields are marked with *