Recombinant Mouse ECEL1 Protein (1-61 aa), His-Myc-tagged

• Cat.No.: ECEL1-2464M
• Product Overview: Recombinant Mouse ECEL1 Protein (1-61 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-61 aa
• Description: May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.7 kDa
• AA Sequence: MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Ecel1 endothelin converting enzyme-like 1 [ Mus musculus (house mouse) ]
• Official Symbol: ECEL1
• Synonyms: Ecel1; xce; DINE
• Gene ID: 13599
• mRNA Refseq: NM_001277925
• Protein Refseq: NP_001264854
• UniProt ID: Q9JMI0