Recombinant Mouse ECEL1 Protein (1-61 aa), His-Myc-tagged

Cat.No. : ECEL1-2464M
Product Overview : Recombinant Mouse ECEL1 Protein (1-61 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 1-61 aa
Description : May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 13.7 kDa
AA Sequence : MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Ecel1 endothelin converting enzyme-like 1 [ Mus musculus (house mouse) ]
Official Symbol ECEL1
Synonyms Ecel1; xce; DINE;
Gene ID 13599
mRNA Refseq NM_001277925
Protein Refseq NP_001264854
UniProt ID Q9JMI0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ECEL1 Products

Required fields are marked with *

My Review for All ECEL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon