Recombinant Mouse ECEL1 Protein (1-61 aa), His-Myc-tagged
Cat.No. : | ECEL1-2464M |
Product Overview : | Recombinant Mouse ECEL1 Protein (1-61 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-61 aa |
Description : | May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.7 kDa |
AA Sequence : | MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Ecel1 endothelin converting enzyme-like 1 [ Mus musculus (house mouse) ] |
Official Symbol | ECEL1 |
Synonyms | Ecel1; xce; DINE; |
Gene ID | 13599 |
mRNA Refseq | NM_001277925 |
Protein Refseq | NP_001264854 |
UniProt ID | Q9JMI0 |
◆ Recombinant Proteins | ||
ECEL1-3421H | Recombinant Human ECEL1 protein, His-tagged | +Inquiry |
ECEL1-2620M | Recombinant Mouse ECEL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ECEL1-3029H | Recombinant Human ECEL1 Protein, GST-tagged | +Inquiry |
ECEL1-2000R | Recombinant Rat ECEL1 Protein | +Inquiry |
RFL12393HF | Recombinant Full Length Human Endothelin-Converting Enzyme-Like 1(Ecel1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECEL1-6731HCL | Recombinant Human ECEL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECEL1 Products
Required fields are marked with *
My Review for All ECEL1 Products
Required fields are marked with *
0
Inquiry Basket