Recombinant Mouse EFHD2 Protein (2-240 aa), His-SUMO-tagged
Cat.No. : | EFHD2-2142M |
Product Overview : | Recombinant Mouse EFHD2 Protein (2-240 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-240 aa |
Description : | May regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. Plays a role as negative regulator of the canonical NF-kappa-B-activating branch. Controls spontaneous apoptosis through the regulation of BCL2L1 abundance. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 42.7 kDa |
AA Sequence : | ATDELASKLSRRLQMEGEGGEATEQPGLNGAAAAAAAEAPDETAQALGSADDELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLQVLARLSEIDVSTEGVKGAKNFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEVKQRKAAFKELQSTFK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Efhd2 EF hand domain containing 2 [ Mus musculus (house mouse) ] |
Official Symbol | EFHD2 |
Synonyms | AA408606; D4Wsu27e; 2600015J22Rik; |
Gene ID | 27984 |
UniProt ID | Q9D8Y0 |
◆ Recombinant Proteins | ||
EFHD2-1216R | Recombinant Rhesus Macaque EFHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFHD2-3095H | Recombinant Human EFHD2 Protein, GST-tagged | +Inquiry |
EFHD2-5430H | Recombinant Human EFHD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EFHD2-1391R | Recombinant Rhesus monkey EFHD2 Protein, His-tagged | +Inquiry |
EFHD2-4214HF | Recombinant Full Length Human EFHD2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFHD2 Products
Required fields are marked with *
My Review for All EFHD2 Products
Required fields are marked with *