Recombinant Mouse EFHD2 Protein (2-240 aa), His-SUMO-tagged
| Cat.No. : | EFHD2-2142M |
| Product Overview : | Recombinant Mouse EFHD2 Protein (2-240 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-240 aa |
| Description : | May regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. Plays a role as negative regulator of the canonical NF-kappa-B-activating branch. Controls spontaneous apoptosis through the regulation of BCL2L1 abundance. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 42.7 kDa |
| AA Sequence : | ATDELASKLSRRLQMEGEGGEATEQPGLNGAAAAAAAEAPDETAQALGSADDELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLQVLARLSEIDVSTEGVKGAKNFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEVKQRKAAFKELQSTFK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Efhd2 EF hand domain containing 2 [ Mus musculus (house mouse) ] |
| Official Symbol | EFHD2 |
| Synonyms | AA408606; D4Wsu27e; 2600015J22Rik; |
| Gene ID | 27984 |
| UniProt ID | Q9D8Y0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFHD2 Products
Required fields are marked with *
My Review for All EFHD2 Products
Required fields are marked with *




