Recombinant Mouse EGFL8 Protein (29-293 aa), His-SUMO-Myc-tagged

Cat.No. : EGFL8-2312M
Product Overview : Recombinant Mouse EGFL8 Protein (29-293 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 29-293 aa
Description : Interacting selectively and non-covalently with calcium ions (Ca2+).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 49.0 kDa
AA Sequence : GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Egfl8 EGF-like domain 8 [ Mus musculus ]
Official Symbol EGFL8
Synonyms EGFL8; EGF-like domain 8; epidermal growth factor-like protein 8; EGF-like protein 8; Ng3;
Gene ID 81701
mRNA Refseq NM_152922
Protein Refseq NP_690886
UniProt ID Q6GUQ1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGFL8 Products

Required fields are marked with *

My Review for All EGFL8 Products

Required fields are marked with *

0
cart-icon
0
compare icon