Recombinant Mouse EGFL8 Protein (29-293 aa), His-SUMO-Myc-tagged
| Cat.No. : | EGFL8-2312M |
| Product Overview : | Recombinant Mouse EGFL8 Protein (29-293 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 29-293 aa |
| Description : | Interacting selectively and non-covalently with calcium ions (Ca2+). |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 49.0 kDa |
| AA Sequence : | GSFKESLGVCSKQTLLVPLRYNESYSQPVYKPYLTLCAGRRICSTYRTTYRVAWREVRREVPQTHVVCCQGWKKPHPGALTCDAICSKPCLNGGVCTGPDRCECAPGWGGKHCHVDVDECRASLTLCSHGCLNTLGSFLCSCPHPLVLGLDGRTCAGGPPESPTSASILSVAVREADSEEERALRWEVAELRGRLEKLEQWATQAGAWVRAVLPMPPEELRPEQVAELWGRGDRIESLSDQVLLLEERLGACACEDNSLGPSLRG |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Egfl8 EGF-like domain 8 [ Mus musculus ] |
| Official Symbol | EGFL8 |
| Synonyms | EGFL8; EGF-like domain 8; epidermal growth factor-like protein 8; EGF-like protein 8; Ng3; |
| Gene ID | 81701 |
| mRNA Refseq | NM_152922 |
| Protein Refseq | NP_690886 |
| UniProt ID | Q6GUQ1 |
| ◆ Recombinant Proteins | ||
| Egfl8-2760M | Recombinant Mouse Egfl8 Protein, Myc/DDK-tagged | +Inquiry |
| EGFL8-1685R | Recombinant Rat EGFL8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EGFL8-1221R | Recombinant Rhesus Macaque EGFL8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EGFL8-2028R | Recombinant Rat EGFL8 Protein | +Inquiry |
| EGFL8-3116H | Recombinant Human EGFL8 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGFL8-6697HCL | Recombinant Human EGFL8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFL8 Products
Required fields are marked with *
My Review for All EGFL8 Products
Required fields are marked with *
