Recombinant Mouse Fcgr4 Protein

Cat.No. : Fcgr4-548M
Product Overview : Recombinant Mouse Fcgr4 protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Protein Length : 261
Description : Enables IgE receptor activity and IgG receptor activity. Involved in neutrophil activation and positive regulation of bone resorption. Located in cell surface. Is expressed in liver. Human ortholog(s) of this gene implicated in several diseases, including allergic disease (multiple); autoimmune disease (multiple); glomerulonephritis (multiple); hematologic cancer (multiple); and immunodeficiency 20. Orthologous to human FCGR3A (Fc fragment of IgG receptor IIIa) and FCGR3B (Fc fragment of IgG receptor IIIb).
Form : Lyophilized
AA Sequence : MFQNAHSGSQWLLPPLTILLLFAFADRQSAALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSVRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTAFSLVMCLLFAVDTGLYFYVRRNLQTPREYWRKSLSIRKRQAPQDK
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Fcgr4 Fc receptor, IgG, low affinity IV [ Mus musculus (house mouse) ]
Official Symbol Fcgr4
Synonyms FCGR4; Fc receptor, IgG, low affinity IV; Fc gammaRIV; Fc receptor-like 3; Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity III, receptor for (CD16); Fcrl3; CD16-2; FcgRIV; Fcgr3a; FcgammaRIV; 4833442P21Rik;
Gene ID 246256
mRNA Refseq NM_144559
Protein Refseq NP_653142
UniProt ID A0A0B4J1G0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fcgr4 Products

Required fields are marked with *

My Review for All Fcgr4 Products

Required fields are marked with *

0
cart-icon
0
compare icon