| Species : |
Mouse |
| Source : |
HEK293 |
| Protein Length : |
261 |
| Description : |
Enables IgE receptor activity and IgG receptor activity. Involved in neutrophil activation and positive regulation of bone resorption. Located in cell surface. Is expressed in liver. Human ortholog(s) of this gene implicated in several diseases, including allergic disease (multiple); autoimmune disease (multiple); glomerulonephritis (multiple); hematologic cancer (multiple); and immunodeficiency 20. Orthologous to human FCGR3A (Fc fragment of IgG receptor IIIa) and FCGR3B (Fc fragment of IgG receptor IIIb). |
| Form : |
Lyophilized |
| AA Sequence : |
MFQNAHSGSQWLLPPLTILLLFAFADRQSAALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSVRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTAFSLVMCLLFAVDTGLYFYVRRNLQTPREYWRKSLSIRKRQAPQDK |
| Purity : |
> 98% |
| Applications : |
WB; ELISA; FACS; FC |
| Stability : |
This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : |
At -20 centigrade. |
| Concentration : |
1 mg/mL |
| Storage Buffer : |
PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : |
Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |