Recombinant Mouse Fcgr4 Protein
Cat.No. : | Fcgr4-548M |
Product Overview : | Recombinant Mouse Fcgr4 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Protein Length : | 261 |
Description : | Enables IgE receptor activity and IgG receptor activity. Involved in neutrophil activation and positive regulation of bone resorption. Located in cell surface. Is expressed in liver. Human ortholog(s) of this gene implicated in several diseases, including allergic disease (multiple); autoimmune disease (multiple); glomerulonephritis (multiple); hematologic cancer (multiple); and immunodeficiency 20. Orthologous to human FCGR3A (Fc fragment of IgG receptor IIIa) and FCGR3B (Fc fragment of IgG receptor IIIb). |
Form : | Lyophilized |
AA Sequence : | MFQNAHSGSQWLLPPLTILLLFAFADRQSAALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSVRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHTAFSLVMCLLFAVDTGLYFYVRRNLQTPREYWRKSLSIRKRQAPQDK |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Fcgr4 Fc receptor, IgG, low affinity IV [ Mus musculus (house mouse) ] |
Official Symbol | Fcgr4 |
Synonyms | FCGR4; Fc receptor, IgG, low affinity IV; Fc gammaRIV; Fc receptor-like 3; Fc fragment of IgG, low affinity IIIa, receptor for (CD16); Fc fragment of IgG, low affinity III, receptor for (CD16); Fcrl3; CD16-2; FcgRIV; Fcgr3a; FcgammaRIV; 4833442P21Rik; |
Gene ID | 246256 |
mRNA Refseq | NM_144559 |
Protein Refseq | NP_653142 |
UniProt ID | A0A0B4J1G0 |
◆ Recombinant Proteins | ||
Fcgr4-2974M | Recombinant Mouse Fcgr4 Protein, Myc/DDK-tagged | +Inquiry |
Fcgr4-5788M | Recombinant Mouse Fcgr4 Protein (Gly21-Gln203), C-His tagged | +Inquiry |
Fcgr4-826M | Active Recombinant Mouse Fcgr4 protein, His-tagged | +Inquiry |
Fcgr4-0296M | Active Recombinant Mouse Fcgr4 protein, His&Avi-tagged, Biotinylated | +Inquiry |
Fcgr4-548M | Recombinant Mouse Fcgr4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR4-2693MCL | Recombinant Mouse FCGR4 Overexpression Lysate(Met 1-Gln 203), His&Avi-tagged | +Inquiry |
FCGR4-1989MCL | Recombinant Mouse FCGR4 Overexpression Lysate(Met 1-Gln 203), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fcgr4 Products
Required fields are marked with *
My Review for All Fcgr4 Products
Required fields are marked with *
0
Inquiry Basket