Recombinant Mouse FHIT Protein (2-150 aa), His-tagged
Cat.No. : | FHIT-997M |
Product Overview : | Recombinant Mouse FHIT Protein (2-150 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-150 aa |
Description : | Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extrely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity . Functions as tumor suppressor. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 21.1 kDa |
AA Sequence : | SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Fhit fragile histidine triad gene [ Mus musculus ] |
Official Symbol | FHIT |
Synonyms | FHIT; AP3Aase; AP3A hydrolase; Fra14A2; AW045638; |
Gene ID | 14198 |
mRNA Refseq | NM_010210 |
Protein Refseq | NP_034340 |
UniProt ID | O89106 |
◆ Recombinant Proteins | ||
FHIT-27014TH | Recombinant Human FHIT, His-tagged | +Inquiry |
FHIT-5874M | Recombinant Mouse FHIT Protein | +Inquiry |
FHIT-0840H | Recombinant Human FHIT Protein (M1-Q147), His/Strep tagged | +Inquiry |
FHIT-5161C | Recombinant Chicken FHIT | +Inquiry |
FHIT-3250M | Recombinant Mouse FHIT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FHIT-6226HCL | Recombinant Human FHIT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FHIT Products
Required fields are marked with *
My Review for All FHIT Products
Required fields are marked with *
0
Inquiry Basket