Recombinant Mouse FLII Protein (495-827 aa), His-tagged
Cat.No. : | FLII-1722M |
Product Overview : | Recombinant Mouse FLII Protein (495-827 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 495-827 aa |
Description : | May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling . Essential for early bryonic development. May play a role in regulation of cytoskeletal rearrangents involved in cytokinesis and cell migration, by inhibiting Rac1-dependent paxillin phosphorylation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 40.0 kDa |
AA Sequence : | VGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGSSLDPRFVFLLDQGLDIYVWRGAQATLSNTTKARLFAEKINKNERKGKAEITLLVQGQEPPGFWDVLGGEPSEIKNHVPDDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKKRPKVELMPGMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHTVVSRSLEGTE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Flii flightless I homolog (Drosophila) [ Mus musculus ] |
Official Symbol | FLII |
Synonyms | FLII; flightless I homolog (Drosophila); Fli1; Fliih; 3632430F08Rik; |
Gene ID | 14248 |
mRNA Refseq | NM_022009 |
Protein Refseq | NP_071292 |
UniProt ID | Q9JJ28 |
◆ Recombinant Proteins | ||
FLII-8204Z | Recombinant Zebrafish FLII | +Inquiry |
FLII-2953H | Recombinant Human FLII Protein (Leu896-Phe1176), N-His tagged | +Inquiry |
FLII-3278M | Recombinant Mouse FLII Protein, His (Fc)-Avi-tagged | +Inquiry |
FLII-1722M | Recombinant Mouse FLII Protein (495-827 aa), His-tagged | +Inquiry |
FLII-2342C | Recombinant Chicken FLII | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLII Products
Required fields are marked with *
My Review for All FLII Products
Required fields are marked with *
0
Inquiry Basket