Recombinant Mouse Fndc5 protein(29-140aa), His-tagged
Cat.No. : | Fndc5-632M |
Product Overview : | Recombinant Mouse Fndc5 protein(Q8K4Z2)(29-140aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 29-140aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE |
Gene Name | Fndc5 fibronectin type III domain containing 5 [ Mus musculus ] |
Official Symbol | Fndc5 |
Synonyms | FNDC5; fibronectin type III domain containing 5; PeP; Pxp; 1500001L03Rik; |
Gene ID | 70364 |
◆ Recombinant Proteins | ||
FNDC5-301596H | Recombinant Human FNDC5 protein, GST-tagged | +Inquiry |
FNDC5-5009HF | Recombinant Full Length Human FNDC5 Protein, GST-tagged | +Inquiry |
Fndc5-632M | Recombinant Mouse Fndc5 protein(29-140aa), His-tagged | +Inquiry |
FNDC5-939H | Recombinant Human FNDC5 Protein, His&SUMO-tagged | +Inquiry |
FNDC5-544H | Recombinant Human FNDC5 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FNDC5-6172HCL | Recombinant Human FNDC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fndc5 Products
Required fields are marked with *
My Review for All Fndc5 Products
Required fields are marked with *