Recombinant Mouse Fndc5 protein(29-140aa), His-tagged
| Cat.No. : | Fndc5-632M |
| Product Overview : | Recombinant Mouse Fndc5 protein(Q8K4Z2)(29-140aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 29-140aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.6 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE |
| Gene Name | Fndc5 fibronectin type III domain containing 5 [ Mus musculus ] |
| Official Symbol | Fndc5 |
| Synonyms | FNDC5; fibronectin type III domain containing 5; PeP; Pxp; 1500001L03Rik; |
| Gene ID | 70364 |
| ◆ Recombinant Proteins | ||
| FNDC5-301596H | Recombinant Human FNDC5 protein, GST-tagged | +Inquiry |
| FNDC5-2376R | Recombinant Rat FNDC5 Protein | +Inquiry |
| FNDC5-7844H | Recombinant Human FNDC5 protein, GST-tagged | +Inquiry |
| FNDC5-4410H | Recombinant Human FNDC5 Protein, GST-tagged | +Inquiry |
| FNDC5-541H | Active Recombinant Human FNDC5 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FNDC5-6172HCL | Recombinant Human FNDC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fndc5 Products
Required fields are marked with *
My Review for All Fndc5 Products
Required fields are marked with *
