Recombinant Mouse FUCA1 Protein, His-SUMO-tagged
Cat.No. : | FUCA1-1217M |
Product Overview : | Recombinant Mouse FUCA1 Protein (18-452aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 18-452 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 66.6 kDa |
AA Sequence : | LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Fuca1 fucosidase, alpha-L- 1, tissue [ Mus musculus (house mouse) ] |
Official Symbol | FUCA1 |
Synonyms | Afuc; Fuca; 0610006A03Rik; 9530055J05Rik; alpha-L-fucosidase 1; alpha-L-fucosidase I; alpha-L-fucoside fucohydrolase 1; tissue alpha-L-fucosidase |
Gene ID | 71665 |
mRNA Refseq | NM_024243.4 |
Protein Refseq | NP_077205.3 |
UniProt ID | Q99LJ1 |
◆ Recombinant Proteins | ||
FUCA1-2983H | Recombinant Human FUCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUCA1-8618H | Recombinant Human FUCA1 Protein, His-tagged | +Inquiry |
FUCA1-4543H | Recombinant Human FUCA1 Protein, GST-tagged | +Inquiry |
FUCA1-5133HF | Recombinant Full Length Human FUCA1 Protein, GST-tagged | +Inquiry |
FUCA1-471H | Active Recombinant Human Fucosidase, Alpha-L- 1, Tissue, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUCA1-1212HCL | Recombinant Human FUCA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUCA1 Products
Required fields are marked with *
My Review for All FUCA1 Products
Required fields are marked with *