Recombinant Mouse FUCA1 Protein, His-SUMO-tagged
| Cat.No. : | FUCA1-1217M | 
| Product Overview : | Recombinant Mouse FUCA1 Protein (18-452aa) was expressed in E. coli with N-terminal His-SUMO-tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 18-452 a.a. | 
| Form : | Tris-based buffer, 50% glycerol. | 
| Molecular Mass : | 66.6 kDa | 
| AA Sequence : | LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
| Gene Name | Fuca1 fucosidase, alpha-L- 1, tissue [ Mus musculus (house mouse) ] | 
| Official Symbol | FUCA1 | 
| Synonyms | Afuc; Fuca; 0610006A03Rik; 9530055J05Rik; alpha-L-fucosidase 1; alpha-L-fucosidase I; alpha-L-fucoside fucohydrolase 1; tissue alpha-L-fucosidase | 
| Gene ID | 71665 | 
| mRNA Refseq | NM_024243.4 | 
| Protein Refseq | NP_077205.3 | 
| UniProt ID | Q99LJ1 | 
| ◆ Recombinant Proteins | ||
| FUCA1-2983H | Recombinant Human FUCA1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| FUCA1-8618H | Recombinant Human FUCA1 Protein, His-tagged | +Inquiry | 
| FUCA1-4543H | Recombinant Human FUCA1 Protein, GST-tagged | +Inquiry | 
| FUCA1-5133HF | Recombinant Full Length Human FUCA1 Protein, GST-tagged | +Inquiry | 
| FUCA1-471H | Active Recombinant Human Fucosidase, Alpha-L- 1, Tissue, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FUCA1-1212HCL | Recombinant Human FUCA1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUCA1 Products
Required fields are marked with *
My Review for All FUCA1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            