Recombinant Mouse Gabpa protein, GST-tagged
Cat.No. : | Gabpa-676M |
Product Overview : | Recombinant Mouse Gabpa protein(Q00422)(1-454aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-454aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 78.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISYQGMEPKLNILEIVKTAETVEVVIDPDAHHAEAEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERLGIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVPPATPTTIKVINSSAKAAKVQRSPRISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVIECEQKKLARMQLHGIAQPVTAVALAATSLQADKEI |
Gene Name | Gabpa GA repeat binding protein, alpha [ Mus musculus ] |
Official Symbol | Gabpa |
Synonyms | GABPA; GA repeat binding protein, alpha; GA-binding protein alpha chain; GABP subunit alpha; GA repeat binding protein alpha; GA-binding protein alpha-subunit; GABPalpha; |
Gene ID | 14390 |
mRNA Refseq | NM_008065 |
Protein Refseq | NP_032091 |
◆ Recombinant Proteins | ||
GABPA-1611R | Recombinant Rhesus Macaque GABPA Protein, His (Fc)-Avi-tagged | +Inquiry |
GABPA-5179HF | Recombinant Full Length Human GABPA Protein, GST-tagged | +Inquiry |
Gabpa-3126M | Recombinant Mouse Gabpa Protein, Myc/DDK-tagged | +Inquiry |
GABPA-1790R | Recombinant Rhesus monkey GABPA Protein, His-tagged | +Inquiry |
GABPA-2992H | Recombinant Human GABPA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABPA-6071HCL | Recombinant Human GABPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gabpa Products
Required fields are marked with *
My Review for All Gabpa Products
Required fields are marked with *
0
Inquiry Basket