Recombinant Mouse Gdf15 protein, His-tagged

• Cat.No.: GDF15-6285M
• Product Overview: Recombinant Mouse Gdf15(Trp31-Ala303) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: Trp31-Ala303
• Form: Lyophilized from a 0.2 μM filtered solution of PBS,pH7.4
• AA Sequence: WPSQGDALAMPEQRPSGPESQLNADELRGRFQDLLSRLHANQSREDSNSEPSPDPAVRILSPEVR LGSHGQLLLRVNRASLSQGLPEAYRVHRALLLLTPTARPWDITRPLKRALSLRGPRAPALRLRLT PPPDLAMLPSGGTQLELRLRVAAGRGRRSAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVL SPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQ TYDDLVARGCHCAVDHHHHHH*
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: Gdf15 growth differentiation factor 15 [ Mus musculus ]
• Official Symbol: Gdf15
• Synonyms: GDF15; growth differentiation factor 15; growth/differentiation factor 15; GDF-15; macrophage inhibiting cytokine-1; SBF; MIC-1; NAG-1
• Gene ID: 23886
• mRNA Refseq: NM_011819
• Protein Refseq: NP_035949
• UniProt ID: Q9Z0J7
• Chromosome Location: 8; 8 C1
• Function: growth factor activity