"Gdf15" Related Products

Expand
Expand

Recombinant Mouse Gdf15 protein, His-tagged

Cat.No.: Gdf15-6285M
Product Overview: Recombinant Mouse Gdf15(Trp31-Ala303) fused with His tag at C-terminal was expressed in HEK293.
Source: HEK293
Species: Mouse
Tag: His
Form: Lyophilized from a 0.2 μM filtered solution of PBS,pH7.4
Protein length: Trp31-Ala303
AA Sequence: WPSQGDALAMPEQRPSGPESQLNADELRGRFQDLLSRLHANQSREDSNSEPSPDPAVRILSPEVR LGSHGQLLLRVNRASLSQGLPEAYRVHRALLLLTPTARPWDITRPLKRALSLRGPRAPALRLRLT PPPDLAMLPSGGTQLELRLRVAAGRGRRSAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVL SPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQ TYDDLVARGCHCAVDHHHHHH*
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: Gdf15 growth differentiation factor 15 [ Mus musculus ]
Official Symbol: Gdf15
Synonyms: GDF15; growth differentiation factor 15; growth/differentiation factor 15; GDF-15; macrophage inhibiting cytokine-1; SBF; MIC-1; NAG-1;
Gene ID: 23886
mRNA Refseq: NM_011819
Protein Refseq: NP_035949
MIM:
UniProt ID: Q9Z0J7
Chromosome Location: 8; 8 C1
Function: growth factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.