Recombinant Mouse Gdf15 protein, His-tagged GDF15-6285M

Recombinant Mouse Gdf15 protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Gdf15 protein, His-tagged

Recombinant Mouse Gdf15 protein, His-tagged

Gdf15 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Gdf15-6285M
Product Overview : Recombinant Mouse Gdf15(Trp31-Ala303) fused with His tag at C-terminal was expressed in HEK293.
Source : HEK293
Species : Mouse
Tag : His
Form : Lyophilized from a 0.2 μM filtered solution of PBS,pH7.4
Protein length : Trp31-Ala303
AA Sequence : WPSQGDALAMPEQRPSGPESQLNADELRGRFQDLLSRLHANQSREDSNSEPSPDPAVRILSPEVR LGSHGQLLLRVNRASLSQGLPEAYRVHRALLLLTPTARPWDITRPLKRALSLRGPRAPALRLRLT PPPDLAMLPSGGTQLELRLRVAAGRGRRSAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVL SPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQ TYDDLVARGCHCAVDHHHHHH*
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name : Gdf15 growth differentiation factor 15 [ Mus musculus ]
Official Symbol : Gdf15
Synonyms : GDF15; growth differentiation factor 15; growth/differentiation factor 15; GDF-15; macrophage inhibiting cytokine-1; SBF; MIC-1; NAG-1;
Gene ID : 23886
mRNA Refseq : NM_011819
Protein Refseq : NP_035949
UniProt ID : Q9Z0J7
Chromosome Location : 8; 8 C1
Function : growth factor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy