Recombinant Mouse GLP1R Protein, His-SUMO-tagged
| Cat.No. : | GLP1R-1229M |
| Product Overview : | Recombinant Mouse GLP1R Protein (22-145aa) was expressed in E. coli with N-terminal His-SUMO-tagged. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 22-145 a.a. |
| Description : | This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 30.4 kDa |
| AA Sequence : | GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPW ASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Glp1r glucagon-like peptide 1 receptor [ Mus musculus (house mouse) ] |
| Official Symbol | GLP1R |
| Synonyms | GLP1Rc; GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331 |
| Gene ID | 14652 |
| mRNA Refseq | NM_021332.2 |
| Protein Refseq | NP_067307.2 |
| UniProt ID | O35659 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLP1R Products
Required fields are marked with *
My Review for All GLP1R Products
Required fields are marked with *
