Recombinant Mouse GLP1R Protein, His-SUMO-tagged

Cat.No. : GLP1R-1229M
Product Overview : Recombinant Mouse GLP1R Protein (22-145aa) was expressed in E. coli with N-terminal His-SUMO-tagged.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 22-145 a.a.
Description : This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 30.4 kDa
AA Sequence : GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPW
ASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Glp1r glucagon-like peptide 1 receptor [ Mus musculus (house mouse) ]
Official Symbol GLP1R
Synonyms GLP1Rc; GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331
Gene ID 14652
mRNA Refseq NM_021332.2
Protein Refseq NP_067307.2
UniProt ID O35659

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLP1R Products

Required fields are marked with *

My Review for All GLP1R Products

Required fields are marked with *

0

Inquiry Basket

cartIcon