Recombinant Mouse GLP1R Protein, His-SUMO-tagged
Cat.No. : | GLP1R-1229M |
Product Overview : | Recombinant Mouse GLP1R Protein (22-145aa) was expressed in E. coli with N-terminal His-SUMO-tagged. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 22-145 a.a. |
Description : | This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 30.4 kDa |
AA Sequence : | GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPW ASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Glp1r glucagon-like peptide 1 receptor [ Mus musculus (house mouse) ] |
Official Symbol | GLP1R |
Synonyms | GLP1Rc; GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331 |
Gene ID | 14652 |
mRNA Refseq | NM_021332.2 |
Protein Refseq | NP_067307.2 |
UniProt ID | O35659 |
◆ Recombinant Proteins | ||
GLP1R-2565R | Recombinant Rat Glp1r protein, His/SUMO-tagged | +Inquiry |
GLP1R-2802H | Recombinant Human GLP1R Protein (24-145 aa), His-tagged | +Inquiry |
GLP1R-3870C | Recombinant Chicken GLP1R | +Inquiry |
GLP1R-22H | Recombinant Human GLP1R Protein, Biotinylated | +Inquiry |
Glp1r-04M | Recombinant Mouse Glp1r Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GLP1R-549C | Recombinant Cynomolgus GLP1R Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLP1R Products
Required fields are marked with *
My Review for All GLP1R Products
Required fields are marked with *