Recombinant Mouse GLP1R Protein, His-SUMO-tagged GLP1R-1229M

Recombinant Mouse GLP1R Protein, His-SUMO-tagged

PRODUCTS

Home / Products / Recombinant Mouse GLP1R Protein, His-SUMO-tagged

Recombinant Mouse GLP1R Protein, His-SUMO-tagged

GLP1R Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GLP1R-1229M
Product Overview : Recombinant Mouse GLP1R Protein (22-145aa) was expressed in E. coli with N-terminal His-SUMO-tagged.
Description : This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Source : E. coli
Species : Mouse
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 30.4 kDa
AA Sequence : GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPW
ASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name : Glp1r glucagon-like peptide 1 receptor [ Mus musculus (house mouse) ]
Official Symbol : GLP1R
Synonyms : GLP1Rc; GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331
Gene ID : 14652
mRNA Refseq : NM_021332.2
Protein Refseq : NP_067307.2
UniProt ID : O35659

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy