Recombinant Mouse GLP1R Protein, His-SUMO-tagged

• Cat.No.: GLP1R-1229M
• Product Overview: Recombinant Mouse GLP1R Protein (22-145aa) was expressed in E. coli with N-terminal His-SUMO-tagged.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 22-145 a.a.
• Description: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 30.4 kDa
• AA Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPW
  ASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Glp1r glucagon-like peptide 1 receptor [ Mus musculus (house mouse) ]
• Official Symbol: GLP1R
• Synonyms: GLP1Rc; GLP1R; glucagon-like peptide 1 receptor; GLP-1R; GLP-1-R; GLP-1 receptor; MGC138331
• Gene ID: 14652
• mRNA Refseq: NM_021332.2
• Protein Refseq: NP_067307.2
• UniProt ID: O35659