Recombinant Mouse Gng12 protein, His&Myc-tagged
Cat.No. : | Gng12-7865M |
Product Overview : | Recombinant Mouse Gng12 protein(Q9DAS9)(2-69aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-69aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFKDKKTC |
Gene Name | Gng12 guanine nucleotide binding protein (G protein), gamma 12 [ Mus musculus ] |
Official Symbol | Gng12 |
Synonyms | GNG12; guanine nucleotide binding protein (G protein), gamma 12; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12; AA536815; AI115529; AI314170; AI842738; 2010305F15Rik; |
Gene ID | 14701 |
mRNA Refseq | NM_001177556 |
Protein Refseq | NP_001171027 |
◆ Recombinant Proteins | ||
GNG12-3810H | Recombinant Human GNG12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNG12-1902R | Recombinant Rhesus monkey GNG12 Protein, His-tagged | +Inquiry |
GNG12-5066H | Recombinant Human GNG12 Protein, GST-tagged | +Inquiry |
GNG12-3771M | Recombinant Mouse GNG12 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNG12-1722R | Recombinant Rhesus Macaque GNG12 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG12-5855HCL | Recombinant Human GNG12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gng12 Products
Required fields are marked with *
My Review for All Gng12 Products
Required fields are marked with *
0
Inquiry Basket